KEGG   Brugia malayi (filaria): Bm1_21620Help
Entry
Bm1_21620         CDS       T01050                                 

Definition
Profilin family protein
Orthology
K05759  
profilin
Organism
bmy  Brugia malayi (filaria)
Brite
Exosome [BR:bmy04147]
 Exosomal proteins
  Proteins found in most exosomes
   Bm1_21620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 130 aa AA seqDB search
MSGWAAYIKNLLDSSQGIQRAAIVGYPDGSVWARSEGDREFRATDEELKKFVTLYDHIEK
VPAVGCDLEGVHYIVPRTEQNLIFGKRDKTGIFAAKTKSAVLIACYKGENAAEVRVAVEK
LAQYLMDSGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggctgggctgcttatatcaagaatctacttgattcaagtcaaggtatacaacga
gctgctattgttggttatccagatggttctgtatgggcaaggtctgagggtgatcgtgaa
ttycgggcaacagacgaggagttaaaaaaatttgtcactttgtatgatcatattgaaaaa
gtgccagctgttggttgcgatttggagggcgtgcattacatagtgccacgaacggaacag
aatctcatttttggtaaacgcgataaaactgggatatttgcagctaaaactaaatcagct
gtgctaattgcttgctataagggggaaaatgcggcggaagtacgtgtagcagttgagaaa
cttgcacaatatttaatggattctggatactga

DBGET integrated database retrieval system