KEGG   Brugia malayi (filaria): Bm1_22105Help
Entry
Bm1_22105         CDS       T01050                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bmy01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bmy01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MVSETETVGAVTDNCMDEVDMETMKVVQEQFLSADANEIKEVSEHSKQVKFKTQIVWRNV
ALFSALHVASLVGIYQFIFLAKWPTLFWYCTCWLMGVMGITAGAHRLWSHRSYKARWPAR
LFLMFCNSMAFQNDVIEWSRDHRCHHKWTDTDADPHNTTRGMFFAHMGWLMVRKHPEVKR
KGSQLDLSDLFNDPILAFQRRHYLKTVLFAWFIVPTFVPMYFWGESFMVALYTCTLLRYC
STLHGTWLINSLAHKYGFKPYNPNITPVESLWLAVTAMGEGGHNYHHTFPQDYRTSEYVL
HFNVTKLFIDILFFLGLAYDMKVVPQEIIERQKAKYVKKCN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaaacagaaacagtaggagctgtcactgataattgtatggatgaggtggac
atggagacaatgaaagtcgttcaggaacagttcctctctgccgatgctaatgaaattaag
gaagttagcgagcactcaaaacaggttaaattcaaaactcaaattgtatggaggaatgtg
gcgctattttcagctctccatgtcgcatcactggtcggtatttatcagtttattttcctc
gccaaatggccaacattattttggtattgcacctgttggctaatgggcgttatgggtatc
actgctggggcacatcgtctttggtctcatcgtagttataaggccagatggcctgctcgg
ctctttttgatgttttgcaacagtatggctttccagaacgatgtaattgagtggtcacga
gaccatcgttgtcatcacaagtggacagatactgatgctgacccgcacaataccacaaga
ggaatgttttttgctcatatgggttggttgatggttcgtaaacatccggargtgaagaga
aaaggctctcaactagatctgagtgatttgttcaatgatcctatacttgcatttcagaga
agacactacttaaaaacagtactattcgcttggtttattgtgccaacctttgtaccgatg
tatttttggggagaatccttcatggtcgctctttatacttgcacattattaagatactgc
tctactctgcatggtacatggctaatcaattcgttggcacacaaatatggcttcaagcct
tacaatccgaatataacacctgttgaatcattatggctagcggtaacggcaatgggtgaa
ggcggtcataactatcatcacacttttccgcaagactatcgaacatctgaatatgtgctt
cactttaatgtaacaaaattattcatcgacatactatttttcttgggattggcatacgac
atgaaagttgtcccgcaagagataattgaacgacagaaagcaaaatacgtgaagaaatgt
aattga

DBGET integrated database retrieval system