KEGG   Brugia malayi (filaria): Bm1_22105Help
Entry
Bm1_22105         CDS       T01050                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bm1_22105
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bm1_22105
Enzymes [BR:bmy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Bm1_22105
Lipid biosynthesis proteins [BR:bmy01004]
 Desaturase
  First
   Bm1_22105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MVSETETVGAVTDNCMDEVDMETMKVVQEQFLSADANEIKEVSEHSKQVKFKTQIVWRNV
ALFSALHVASLVGIYQFIFLAKWPTLFWYCTCWLMGVMGITAGAHRLWSHRSYKARWPAR
LFLMFCNSMAFQNDVIEWSRDHRCHHKWTDTDADPHNTTRGMFFAHMGWLMVRKHPEVKR
KGSQLDLSDLFNDPILAFQRRHYLKTVLFAWFIVPTFVPMYFWGESFMVALYTCTLLRYC
STLHGTWLINSLAHKYGFKPYNPNITPVESLWLAVTAMGEGGHNYHHTFPQDYRTSEYVL
HFNVTKLFIDILFFLGLAYDMKVVPQEIIERQKAKYVKKCN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaaacagaaacagtaggagctgtcactgataattgtatggatgaggtggac
atggagacaatgaaagtcgttcaggaacagttcctctctgccgatgctaatgaaattaag
gaagttagcgagcactcaaaacaggttaaattcaaaactcaaattgtatggaggaatgtg
gcgctattttcagctctccatgtcgcatcactggtcggtatttatcagtttattttcctc
gccaaatggccaacattattttggtattgcacctgttggctaatgggcgttatgggtatc
actgctggggcacatcgtctttggtctcatcgtagttataaggccagatggcctgctcgg
ctctttttgatgttttgcaacagtatggctttccagaacgatgtaattgagtggtcacga
gaccatcgttgtcatcacaagtggacagatactgatgctgacccgcacaataccacaaga
ggaatgttttttgctcatatgggttggttgatggttcgtaaacatccggargtgaagaga
aaaggctctcaactagatctgagtgatttgttcaatgatcctatacttgcatttcagaga
agacactacttaaaaacagtactattcgcttggtttattgtgccaacctttgtaccgatg
tatttttggggagaatccttcatggtcgctctttatacttgcacattattaagatactgc
tctactctgcatggtacatggctaatcaattcgttggcacacaaatatggcttcaagcct
tacaatccgaatataacacctgttgaatcattatggctagcggtaacggcaatgggtgaa
ggcggtcataactatcatcacacttttccgcaagactatcgaacatctgaatatgtgctt
cactttaatgtaacaaaattattcatcgacatactatttttcttgggattggcatacgac
atgaaagttgtcccgcaagagataattgaacgacagaaagcaaaatacgtgaagaaatgt
aattga

DBGET integrated database retrieval system