KEGG   Brugia malayi (filaria): Bm1_22520Help
Entry
Bm1_22520         CDS       T01050                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Bm1_22520
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Bm1_22520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1281 aa AA seqDB search
MSKGTSSKRRHGCKTLREQNDATSSYTRSSVTASSNSNTSLCPLIFNGPSLPGGDINRSP
PESMPCEPSTSSIHQVADETADLNSEVLLPLPVLSTMDTTGPLANLDDNNHCYVGLVNQA
MTCYLNSLIQTLYMTPEFRNAIYGWKFTGSEAAEARSIPCQLQKLFLLLQTSDRESLETI
DLTASFGWSNSEAYEQHDIQELCRIMFDALKQKWSKADASFQELYRGNMEDFVKCLFCQK
ENIKQDEFLDLPLAVKQFGATDAFKSVEEALHAFIKPEVLEGSNQYYCEGCRRKQNALKG
LRIIKFPYLLSIQLKRFDFDCNTLHRIKLNDKMTFPALLNLNEFVYDATKSEPPKKISWA
SAVSVSRKKDEPTTSKPNLSDYVSRAEQNNGHLDEQEVDMLLKRDGPFLYELFSVMVHQG
SASGGHYFAYIKNMDQDKWFCFNDSNVTPASIEDIHRTFGGSCGGWSSGNTNAYMLMYRQ
IDRKRNARFIKTGELADHLLERLRRFEELEEEKLREKQYKESLVSVNIMFNGAHXIPDVA
NLTEAMKFPYTTKLSEIYDAILKAFCAKTSVSVSDVRLLLCKDFTYSIIRSFTENEMQKT
LEEVYPGCSVKSLYRPIVYFLLDVKPSEAQQFYHIYDDESVGTVKLIALNIENGTFLPSF
QMQYHDNETMSMIKQKLGQIFHICGDKTDNMRLVIDKGIAASPTMVLLDDDSFTCAQALL
NITNVKLYVDVGGSGYSTDEDRKIDFDKSKMFALLERRNHAKILTISLPTPDDYIQAGII
PSLSHDVSRSTTPIGSMPADTNTTTSGSCSAVIDLRSVPASGIPETLTMKQTTPSMASSH
LSSVISEEDNNSPCLVLLNMKIKDGDGDMESVSTACTPMVSPVVSDSDDTADVTARDSAV
DRISRYERTYDAVMAASEQKRLFEMESTVEVEASIASSSGDTLVGGTHTYISGTTQSSFD
IIIRGKSRVKSLNDVEVDVDDRQLVIHMKQWLSAVIGVDMNEFVVLKHYSTDDADGYESI
INETETIHDAYYAVQKLSVKLRSPLKENEKLMRIIRFDRENADLDKWPTLFSIPTTVDMQ
IRTLLMRCQEQMKKVYATKYDLNQLRLREVIVGGGAPVLFLGDQLGRRGHDWNKNLYLQF
LSDEEVARAKMHTSASYPVMVRRWKSSVPEVTSLVELMIPVDKQNQAFPTTAWSKWPYTK
DRVDLYENVSFTNGEAPSNGTFNGKLIYFKLAYEQVRQLTEKEKRSLRFKDNVIKPGDGT
ISRRKERPLRIQLSTSITEDD
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggtacatcaagtaaacgtcggcatggctgtaaaacgctacgtgaacaaaat
gatgcaacttcaagttatacgagatcatctgttacagcttcaagtaattccaatacaagc
ctctgtcctctaatctttaatggaccatcattacctggcggcgatataaatcgctctcct
cccgaaagtatgccctgtgagccgtccacttccagcatccatcaggttgccgatgaaact
gctgatttgaactcggaagttttgttgccattaccggttctttcaacaatggatacaaca
ggaccgttggctaatttagacgataacaatcattgttacgttggtttagtcaatcaagct
atgacttgttatctgaattcactaatacaaacgttatatatgacacctgaattccgaaat
gcaatttatgggtggaaattcaccggttctgaagctgcggaagctagaagcattccatgc
caactacaaaaattgtttttgcttctgcaaaccagtgaccgtgaatcgctggaaactatt
gatttgactgcatcttttggttggagtaattccgaggcttacgarcaacatgatatccag
gagttatgcagaataatgtttgatgcattaaaacagaaatggagcaaagcagacgctagy
tttcaggaactatacaggggtaatatggaggattttgtcaaatgtcttttctgtcaaaag
gaaaatatcaagcaggatgaatttctggatttgccattagcagtgaaacaatttggtgcc
actgatgccttcaaaagtgtggaagaggcacttcatgctttcatcaaacctgaagtgctg
gaaggaagtaatcagtattattgtgaagggtgcagaaggaagcaaaatgcgttaaagggt
ttgcgaataataaaatttccctatttgctgtcaatccagcttaaacgttttgattttgat
tgcaatacacttcatcgtatcaaattaaacgacaaaatgaccttcccagcattactaaat
ttgaatgaattcgtttacgatgcaacgaaaagtgagccaccgaagaagatcagttgggca
tcagcagtctcagtgtcaaggaaaaaagatgagccaacaacatcaaaaccaaatttatct
gattatgtatctcgtgcggaacagaataatggtcatttggacgaacaagaagttgatatg
ttacttaaaagagatggtccatttctctatgaattattttcggttatggtacatcaaggg
agtgcttcaggaggccattatttcgcatatatcaagaacatggatcaagataaatggttt
tgctttaatgacagtaacgtaactcctgcttcaattgaagatatacatcgtacatttggt
ggttcttgtggtggttggtcatcgggaaatacaaatgcttatatgttgatgtatagacag
attgatcgtaagcgaaatgcaagatttataaaaactggtgaattagcggaccatcttctg
gagcgtttgaggcgatttgaggagctagaagaagagaaacttcgagaaaaacaatacaaa
gagtcgcttgtttcggttaacataatgttcaatggagctcataytataccagatgttgct
aatctaacggaagcaatgaaatttccatacacaacgaaattatccgaaatttacgatgca
attcttaaggcattttgtgctaagacttctgtttcagtttctgacgttcggctgctgttg
tgcaaagatttcacttattcaattatacgttcattcacagaaaatgaaatgcaaaagaca
ttggaagaagtatatcctggatgttccgtaaagagtttataccgcccgattgtatatttt
ctgttagatgttaaaccgtctgaggcacaacagttttatcatatttatgacgatgaatca
gttggcacagtaaaattaattgcacttaatattgaaaatggaacctttctgccatcattt
caaatgcaatatcacgataatgaaacaatgagtatgataaagcagaaattgggacagatt
tttcatatttgtggtgataaaaccgacaacatgcgtttggtaattgataaaggaattgct
gcatcaccgacaatggttttgcttgatgatgacagttttacctgtgcacaagctctgctt
aatatcacaaatgtcaaattgtatgtggatgttggtgggagtggttattcaacggatgaa
gatcgaaaaatcgactttgataagtcaaagatgtttgcacttttagaaagaagaaatcat
gcaaaaatattgacaataagtcttccaacaccagatgattatatacaagctggaattatt
ccatcactttcgcatgatgtcagtcgttcaacaactccgataggtagtatgcctgctgat
acaaatacgacaacatcaggatcttgttcagcagttattgatctacgtagtgttcccgct
tcaggtataccagaaacgcttacaatgaagcagacaactccctcaatggctagtagtcat
ttgtcatcggtaatttccgaggaggataataatagtccgtgcttggtattattgaatatg
aaaattaaggacggtgatggtgatatggaatctgtaagcacagcatgtactccgatggta
tcaccggttgtatctgatagtgatgataccgctgatgttactgctagggattccgccgtt
gatcgaataagccgttatgaacgaacgtatgatgcagtcatggcagcttccgaacaaaaa
cggttatttgaaatggagagtacagtagaagttgaagcaagtattgcaagctcctctggt
gatacacttgtgggtggcacacatacatatatttccggaacaacacaatctagttttgat
attatcattcgtggaaaatcacgagtgaaatcactcaacgatgttgaagtagatgtagac
gatcgacagttagttattcacatgaagcaatggttatcagctgtaattggagttgatatg
aatgaatttgttgtcctcaaacattacagtactgatgacgctgatggttatgaaagcatt
attaacgaaacggaaactattcatgacgcttactatgctgttcaaaaactgtcggtgaag
ttgcgttcgccgttgaaagagaatgaaaaattgatgcggattatcaggtttgatcgtgaa
aacgctgatttagataagtggcctacattgttcagtattccaactactgttgatatgcaa
atacgtacattattgatgcgttgtcaggaacagatgaaaaaggtgtatgctacaaaatac
gacctcaaccaattacgattacgagaagtgattgttggtggcggagcaccagtattgttt
ctgggtgaccagctcggcagacgtggtcacgattggaacaaaaatttgtatttgcaattt
ctctcagatgaagaagttgcacgagcaaaaatgcatacatcagcatcttatccagtgatg
gtgagacgttggaaatcatcagtgccagaagtaacatctttggttgaactaatgatacca
gtagataagcagaatcaggcatttccaacaactgcttggagtaagtggccatatacgaag
gatagagttgatttatatgaaaacgttagttttacaaatggtgaagcaccatctaacgga
acatttaatgggaaactcatctatttcaaattagcttatgagcaagtgcggcagttaaca
gagaaggagaaacgttcattaagattcaaagataacgttataaaacccggcgatggtacg
atttcgcgaaggaaagaaagaccactgaggatacagttatcgactagtatcaccgaagat
gattaa

DBGET integrated database retrieval system