KEGG   Brugia malayi (filaria): Bm1_22850Help
Entry
Bm1_22850         CDS       T01050                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 968 aa AA seqDB search
MQRTDSLKYGEYKQSPDLHVVRVTQKEILIDAVTFHERSLQIDFHCLLDSDPILLKYEVD
KSVQLIWHAELAHDIIPEECQMRSDDREYVLKKRDPNQWTSGLLQCNSSSALSALRSSST
TTSPHTSRPSISYRYIGSTADRSGLPPTGQSSNWISSHGSKYQRTSYYPTSRIAYSAQNF
NFNTYGNYPSTTLRSQSTSSVLRRSSSSSLFSSASSASSNIAQNSLNDSQHSTGSALKQT
IPPSSSPTSRPTAKVLPYDEQGTVVDCGFTGLRNIGNTCFMNSTLQMLVNCKELQVYFSG
GYYKRDINIMNPLGFGGRLAEVFAEFMKQMWNGMNRAYEPTKIKELVAEKATQFANFAQH
DAHEFLSFVLDGLHEDLNRVRVKPTTNTIEAEGRPDIEVSREAWHNHLLRNDSIFVDLFH
GQLKSRLQCPKCNQISITFDPFAYLAVPFPKEKRSSTVYFWPLDPCLKPVRIIVRYNADG
KISEVLDALSRLVNVNPKSMRIIEVNNHRIVRVYNPDDSVNNILTTDIIYVFQVHDPYDC
NDDIVEFAVVQRLLYRKGIGRACAFCHATDVKLKTCERCYDAFYCNRECQVKNWPDHKIG
CRSRTQAEAVGQPFIISLPKKRATYSNIMRNLESRCKHSVNVFQPPVENNNDAVVDPLES
SRESYVGSSSCFSASAINGNIDDLPVVPVAAKRQMVLGEPRNKSRTESKLFLVRKLQQSD
AVFGDTLVDSRSDTALDLPNGTFLSINWWNLKCGKEYLTVETKRDVDVDIEKTAYYQKMS
SSMASSSSIASNPSLYDMLAMFSETERLKPEESWYCSKCKEHVEATKQLVLYRLPPILII
QLKRFIYTTSLMTVHRRSKDDRPVRYPLDNLDLAQFLSDTAPSGQETKYDLTGVVCHSGS
SYFGHYISLGRLLSIDGKTIEIDWRNFDDSIVTRAQLSRVQNDDAYLLFYKQRGRATQDL
LKKHYGIG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgaacagattctttgaaatatggtgaatataaacaatccccagatctacatgtt
gttcgtgtaactcaaaaggaaattcttatcgatgctgtcacttttcatgaacgttccctg
caaattgattttcattgcctgttggattcagatcctattttattaaaatatgaagtggat
aaatcagtgcaactcatttggcatgcagagcttgcacatgacataataccagaagagtgc
cagatgcgttctgatgatcgagaatatgtgctaaaaaaacgagatccaaatcagtggact
tcaggcttgctgcaatgtaattcatctagtgccttatcggctttacgttcctcatctact
actacatcccctcatacatcacggccaagcatttcatatcgttatattggttccacagct
gatcgatcaggtttacctcccacaggacaatcttcaaattggatttcttcgcatggttct
aaatatcagcgtacctcttattatcctactagtcgaattgcatattcagcgcaaaatttc
aattttaatacatatggaaattatccatcaacaacgctacgatcacagtcaacaagttca
gttttgcgaagatcttcctcatcgtcgttattttcgtcagcttcttcagcttcttcaaat
attgctcaaaactcactaaatgattcgcaacattcaacaggtagtgcattgaaacaaact
atccctccttcatcatctccaacaagtcgtccaacagcaaaggtattaccatatgatgag
caagggacagtagtcgattgtggttttactggtctgaggaatattggaaatacatgtttc
atgaattctactttgcaaatgcttgttaactgcaaggaacttcaagtttactttagcggt
ggttactacaagagagatatcaatataatgaatccacttggttttggtggacgtttggca
gaagtttttgcagaatttatgaagcagatgtggaatggtatgaatcgtgcttatgaacca
acaaaaataaaggaactagtggctgaaaaggctacacagtttgcaaattttgcccaacat
gatgcccatgaatttttgagtttcgtattggatggattgcacgaagatcttaatcgagtt
cgagtaaagcctacaacaaatacgattgaagctgaaggacgaccagatattgaggtttca
cgtgaagcatggcataaccacttgttgcgtaatgactccatttttgtggatctctttcat
ggccaattgaaatccagacttcagtgtccgaaatgtaatcagatatcaattactttcgat
ccgtttgcttatcttgctgtaccatttccaaaagagaaacgttcttctacggtgtatttt
tggcctcttgatccatgtctcaagccagttcgtattatagtgcgatataatgcagatggg
aaaatttcagaggtactagatgcattatcgcgattggttaatgtaaatccaaaatctatg
cgcataattgaagtaaataaccatcgtattgttcgcgtatataatccggatgacagcgtt
aacaacatacttaccacggatattatttatgtttttcaagtacatgatccttatgattgc
aatgatgatattgttgaatttgctgttgttcagcgtcttctttatcgtaagggtatcggt
cgtgcttgtgctttctgtcatgcaacagatgtaaaactaaaaacgtgcgagcggtgttac
gatgctttctattgcaatcgcgaatgtcaagtgaagaattggccagatcataaaatcggc
tgtagatcacgtactcaagcggaagctgttgggcaaccgttcatcatttcgttacctaaa
aaacgagctacttattcgaatattatgaggaatttggaaagtcgttgcaaacattcggtt
aatgtatttcaaccaccagttgaaaacaataacgatgcagtggttgatccattagaatct
tctcgtgaatcatatgtgggttcaagctcatgcttttcagcatctgctattaatgggaat
attgatgatttaccggtagttcctgttgcggcgaaaagacagatggttcttggtgagcca
cgaaataaatcacgaacggaatcaaaattattcttagtacgtaaactgcaacaatcggat
gctgtatttggtgatacattggttgattcacgctctgatacagctttggatttgccaaat
ggaacttttctttcaattaattggtggaatttgaaatgtggtaaagaatatttaacagtt
gaaacaaaaagagatgtggatgtygatatcgaaaaaaccgcttactatcaraaaatgtca
tcatcaatggcaagttccagtagcattgcttcaaatccatcgttgtatgatatgttagca
atgttttcggaaacggaacgtcttaaaccggaagaatcctggtactgcagtaaatgtaaa
gaacatgtagaagcaactaaacagcttgttttgtatcgcttacctcctattttgatcatt
cagttgaaacgtttcatttatacaacatcgctgatgacagtacatcgtcgttccaaggat
gatcgtcctgttcgatatccacttgataatcttgatttggctcagtttttatccgacact
gctccatcaggacaggaaacgaaatatgatttgacaggtgtagtatgtcattctgggagt
agctattttggacattacatatcgttaggtagactgctaagtattgatgggaaaacgatt
gaaattgattggcgtaattttgacgattcgattgttacacgtgcccaactttcacgtgtt
caaaacgatgatgcttacttgctattctataagcagcgtggaagagcaacacaggatttg
ctaaagaaacattatggtattggataa

DBGET integrated database retrieval system