KEGG   Brugia malayi (filaria): Bm1_25835Help
Entry
Bm1_25835         CDS       T01050                                 

Definition
Protein kinase sperm-specific MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bmy04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MAYTQQLLDVKFNLDNTPYKSIENIGTGTYGVVCKAFDQRNDRKVAIKKITRAFSIAVLL
KRSLREIRILRCLRHENIVTMHDVFAAPGSHGLDVYMVLDLMETDLHQIIHSRQDLTNQH
YQYFLYQILRGLKYLHSVGIMHRDLKPSNLLVNSDCLLKIGDFGMARLIEQQLNDQSVLL
NGNFMTQYVSTRWYRAPELLFSLIDYDTKVDVWSAGCIFAEMLLRRQLFPGKDVGSQVKI
IVYYLGTPEQDVMERISSNLIIRWIESCGPKNPLPWSTIVPKANPQALDLLKKLLVIAPW
KRITAEEALCHQYLEIYHDTASEPNCPKKVYFDAREIERLSIDQLECALLAETSGSYTQQ
SSNR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcatatacgcaacaattattggatgtgaaattcaatttggataatactccctataaa
tcaattgaaaatattggcactggaacatatggagtggtatgcaaagcatttgatcagcga
aatgatcgaaaagtagcaataaagaagataactcgagcattctcaattgcagtccttctg
aaaagatcacttcgtgagatacgtatactgcgatgtttacgtcatgaaaatattgttacg
atgcatgatgtattcgctgcacctggatcacacggtttggatgtttatatggtacttgat
ttgatggagactgatttacatcagattatacacagtcgacaggatcttactaatcaacat
tatcagtactttttatatcagatattacgcggattaaagtatctgcattcggtgggtata
atgcatcgtgatttaaaaccgtcaaatttgttggtcaacagtgattgcctattgaaaata
ggcgattttgggatggctcgattgattgaacagcaattgaatgatcaaagcgttttatta
aatggcaattttatgacccaatacgtctcaacaagatggtatagagcacctgagttgctt
ttctcacttattgattatgatactaaggtggatgtatggtcagcaggttgtatattcgcc
gagatgcttcttcgtcgacagctatttccaggaaaagatgtcggaagtcaagttaaaatt
attgtttattatttgggtacaccggaacaggatgtaatggaacgtattagctcgaatctt
atcattcgttggattgaaagttgtggaccaaaaaatccgctcccatggagtacaattgta
ccaaaagcaaaccctcaagcattggatctgctgaaaaagctactagtaatagcaccttgg
aaacgaataacagcagaagaagccctatgtcaccaatatttggagatttatcacgataca
gctagtgaaccgaactgtccaaaaaaagtatacttcgacgcaagagaaatcgaaagattg
agtatcgatcagttggaatgcgcacttctagcagaaacttcaggatcttacactcagcag
tccagcaataggtag

DBGET integrated database retrieval system