KEGG   Brugia malayi (filaria): Bm1_26360Help
Entry
Bm1_26360         CDS       T01050                                 

Definition
(RefSeq) hypothetical protein
  KO
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Bm1_26360
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C67
   Bm1_26360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 902 aa AA seqDB search
MDGFFNGQRLFSAPHNGAVLVSGDRLRNPRNISILDEDPTFSVYGFPSHLDRYSDDYSPL
RQVYRNSLHREREAIGIPMSTSSIQNEGTIIPITRLESNNSSSNNSFNRPVIREVPIRIV
SATNSHSQTPRPSCPASSTSLAVGRFPVDDTDDNCMSLDVNQGYQMQERADINSKVSLSK
KPVYDNVSSRLPFLKDSSHSLSVIRPAKLQVATETVRLKLNDGELMEGDRVVWFDALGIP
RRGTARWIGYLRGHTNVYVGVDFDEAIGGGTGYFECVELFRSAPNHAGLLPISVCMKEAD
MNXEENNTSDIGNIGLRQSLSEPQQQQQQQQQQQQPQQQQQQQQQQQSSLSAPVRIYENK
SSSQPELLVNXKQNEETSKLPQFTVGSCVEVFYRNELRCGVVKWIDNNNELIQSKRLVAV
EIEGDLPYDWRMVDKMQLEDARKAGVFASAVPDSIALVPYYALRSDDRFALSDISEGNNN
YETKTMVSSNFGSLDSGIEVRPCLPVKNIDNLLGRMKGIQGFRNSCYLDTTLYAMFSQCS
AFDSILESRRETEADSVHTEVTDILKTEIVYPLRRFHFVRADHVLKLRRLLEVLLPKMKG
LTTDEKDPEELLNALFNTVLRVEPFLVMRNTTDGKTNPAYICPLITEDLWSEKQRRLISV
QTLLERSLFASNIQFACEPKILILQLPRYGQQKVFDKIFPPQEMDITHLIHEGKRPCVNC
GKRADMMCPECFLTREVFIGEVTYCGICYEQTHNGLDHQPQQLSISSNSFSISSSLSLSR
RTQVPQKKLQLASVLCIETSHYVAFVHALYTNKWVFFDSMADRVGLSDGYNVPQVKLCEK
MSNWLSDAGWCRVRDCVNREGHLPNDVENDSDLMRLLSDCYICFYTDEENKNEGLSLSRF
FS
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggatggatttttcaatggtcagcgactattttctgctcctcataatggagctgtcctg
gtaagtggtgatcgtctgagaaatccaagaaatataagtattttggatgaagatccaaca
ttctccgtttatggctttccatcgcatttggatcgatattctgatgattattcgccgtta
cggcaagtttatcgaaattctttacacagagaacgcgargctattggtatccctatgtca
acatcatcaattcaaaatgaaggcactattattcccataactcgtctcgaaagcaataac
agtagcagtaataattctttcaatcgtccagtgattcgagaagttcctatccgaattgta
tcagcaacaaatagtcatagccaaacaccaagaccaagctgtccagcatcgtctacttca
ttggccgttggcagatttccggtggatgatacggatgataattgtatgagcttggatgtt
aatcaaggctatcaaatgcaagaaagagctgatatcaactcgaaagtttcattatcgaaa
aagcctgtttatgataatgtgtcatcaaggctaccatttttgaaggactcgtctcatagt
ttatcagtgattagaccagcaaagcttcaggtggctacggaaacagtaaggttaaaatta
aatgatggagaattaatggagggtgatcgtgtagtctggttcgatgcattaggtatacca
cgtcgagggacagctcgatggattggttatcttcgtggacatacgaatgtttacgttgga
gttgattttgatgaagcaataggtggtggaacaggatattttgaatgtgttgagttgttc
cgttctgcaccaaatcatgcaggtctactgccaatatcggtatgcatgaaagaagcagat
atgaatgrtgaggaaaataatacttcggatattggaaacattggactaagacaatcttta
tctgaaccacaacaacaacaacaacagcagcaacagcaacaacaaccacaacaacaacag
caacaacaacaacaacaacaatcgtcattgtcggcaccggttcgaatttatgagaataaa
tcttcttcacagccagaattattggttaatgawaaacaaaacgaggaaacatccaagtta
ccgcaatttactgtaggatcatgcgttgaagtattttatcggaacgagttgcgctgtggt
gttgttaaatggatcgataataataatgagttaattcaaagcaagcgtttagttgctgtt
gaaattgaaggagatttaccatacgattggcgcatggtggataaaatgcaacttgaagat
gctcgtaaagctggtgtttttgcaagtgctgttccggattcaatagctttagtgccatat
tatgcacttcgatctgatgatcgtttcgctttatcggacatttctgaaggcaataataac
tatgaaacaaaaacaatggtgtcatcaaatttcggaagtttggatagtggtattgaagtc
cgaccgtgtttaccggtaaaaaatatcgacaatttgcttggacgcatgaaaggtattcaa
ggtttccggaatagttgctatctcgacacaacgctttatgctatgttttcgcagtgttca
gcatttgatagcatattggaaagcagacgtgaaactgaggcggattcagttcatacagaa
gtcaccgatattttgaaaactgaaattgtttatccactgcgaaggtttcattttgttcga
gccgatcatgtgttaaaattacgacgattattggaggtactgttgcctaaaatgaaaggt
ttaacaactgacgaaaaagatcctgaagagttactgaatgccttgttcaatacagtattg
cgggttgaaccgttccttgtaatgaggaacacgacagatggcaaaacaaatccggcatat
atatgtccattaataacagaagatctatggagcgaaaaacagcgtcgattaattagtgtg
caaacacttctcgaaagatcactttttgcatctaatattcagtttgcatgtgaaccgaaa
attttgatccttcagttaccacgatatgggcaacagaaagtttttgacaaaatatttcca
cctcaggaaatggatatcactcatcttattcatgaaggtaaacgaccctgtgtaaattgt
ggcaaacgtgccgatatgatgtgtcctgaatgcttcttgacaagagaggtcttcattggt
gaggtaacatattgtggtatatgttatgaacaaacccacaatggtttagatcatcaacca
caacagttatccattagcagtaattcgttttcgatttcatcatctttgtcactatctcga
cgaacgcaggtaccacaaaagaagcttcaacttgcatctgttctttgcattgaaacttct
cattatgtagcgttcgtgcatgctctttacactaacaaatgggtatttttcgattcgatg
gctgatcgagtgggtctttcggatggctataatgtcccacaggtgaaattgtgtgaaaaa
atgtcaaattggttgagtgatgctggttggtgtcgagttcgtgattgtgttaaccgagaa
ggacatttgccgaatgatgttgaaaacgattcggatttgatgcgattattgagtgactgt
tatatttgcttctatacggatgaagagaacaaaaatgaaggtctcagtttgtcacgtttt
ttctcctga

DBGET integrated database retrieval system