KEGG   Brugia malayi (filaria): Bm1_27085Help
Entry
Bm1_27085         CDS       T01050                                 

Definition
Aldose 1-epimerase family protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_27085
   00052 Galactose metabolism
    Bm1_27085
Enzymes [BR:bmy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bm1_27085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MLRLITIEQFGMTKASEERVVKISLTNNNGMKIELLNYGAILMSALVPDRNDILRDIVLG
FRTLQEYESDAYNIGAIIGRVAGHISNGKFAVDSREYELGLNAPPHHMNGGRRGSLSKKL
WNYELLDEGNGVCFTCISHDGEGGYPGQVHLEVTYILTNENEIIIDYRASTNKSTILNIA
NNAYFNLNGEGKSSLNDHIIQLCTPNYLPADEXGFATDLLDNDNNQLDYNHDFCFEIDEL
NTSRKIRHIASVASTSSGIKMTVSTTYPCVHVNMGSWLNNLTGKANHVYERYSAFTLQCR
GLSDAINQPHFPTIILRPDELYQHLTVYRFGLVDE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctacgactaattacaattgaacaatttggtatgacaaaagcaagcgaagaacgcgtg
gtgaaaatttcattaacaaataataatggaatgaaaattgaattattaaattatggtgca
atattaatgagtgctttggtgcccgaccgtaatgatattctacgagatattgtgcttgga
tttcgaacactgcaagaatatgaatcggatgcttacaatattggtgcaataattggtcgt
gttgctggacatataagtaatggaaaatttgcagtggacagtcgagaatatgaacttggc
ctaaatgcgccaccacatcatatgaatggcggtagacgaggaagtttatcgaaaaaatta
tggaattatgaattattagatgaaggaaatggtgtatgtttcacatgtattagccatgat
ggcgaaggaggatatccaggacaggtgcatttagaggttacatatatattaacaaatgaa
aatgaaataataattgattatcgagcttcaactaataaatcaacaatattaaacatcgca
aacaatgcttatttcaacttaaatggcgagggaaagtcgtcattaaacgatcacattata
caattgtgcactccaaattatcttccagcagatgagaakggttttgcaacagatttattg
gataatgataacaatcagttagattacaatcacgatttctgttttgaaatagatgaatta
aatacatctcggaaaattcgacatattgccagtgtcgcatctacttcaagtggcattaag
atgacagtttctacgacatatccatgtgtacatgttaatatgggttcctggttgaataat
cttaccggtaaagcgaatcacgtttacgaacgttattcggctttcacgttacaatgtcgc
ggtctaagtgatgcaataaatcaaccacactttcccacaattattttacgaccggatgaa
ctgtaccaacatcttactgtttatcgatttggacttgttgacgaataa

DBGET integrated database retrieval system