KEGG   Brugia malayi (filaria): Bm1_27830Help
Entry
Bm1_27830         CDS       T01050                                 

Definition
Protein kinase domain containing protein
Orthology
K05125  
discoidin domain receptor family member 2 [EC:2.7.10.1]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 607 aa AA seqDB search
XRTERGXGAWCPRQQINSETVEWLQIDFDMDMVITAVETQGRFDGGRGLEYAPSYMLEYW
RESLGTWARYKDGKQNEVMAGNSDTQSTVFRALDGGVVARNLRVIPVSEVTRTVCMRIEL
YGCSYRDQILSYVIPEGDIIDGLNLRDISYDGITNSSGYLVKGLGKLYDGAVGMDNFESY
PEKWIGWNREKRGATITIEVLFAKKKIINAILFHVSNFLKSGAQRTSPNAYCMTNDNMQN
SLLEKLHANQSSGSEYAEPNYISNDMEIIGVNNTTICDPTKSLTNSTIHYASNDVCMRHP
RQLGYALMENSMTSQIASGYDTNRSTNFVEIDSKCLRFHEHLGNSRFGEIWLCQLEQRTM
VNKTFHRSRDNRREFEIIVGELSSLRHQNILEVIGVCFDGVLTSCIHEYIEQYLDQYLRS
LNNEISYRTELLLSVSTQIAAGMSYLESKNFIHGNLSASNCMVANDGTVKLTNFNMAYTL
DHLETDDPIDRGRMRWMSWEAVAEKKITIKGDVWSFGVTLWEVLNGCHKYPYKMMTDNDV
YRNLLFMRQNGMLKFYLERPDFSSVNFYQEFILPCWNGNSEERPTFHSLHRRLQNVTCAQ
MSEDCYY
NT seq 1825 nt NT seq  +upstreamnt  +downstreamnt
gawacggacggaacgtggaartggtgcgtggtgtccacgtcaacaaatcaactctgaaac
agttgaatggctacaaattgattttgatatggatatggtgataacagctgttgaaacaca
aggacgtttcgatggcggacgtggtctggaatatgcgccaagttatatgttggagtattg
gcgtgaaagtcttggtacttgggcacggtataaagatggaaaacaaaatgaagtgatggc
tggaaatagtgatacgcaatcgacagtatttcgagctttagatggtggtgttgtggcacg
aaatttacgtgttatacctgtttctgaagtaacgcgtaccgtttgcatgcgtattgaact
ctatggatgttcttatagagatcaaattttatcctatgtaataccggaaggtgatataat
agacggtttaaacctgagagatatatcgtatgacggaattacaaattcatcagggtattt
ggtcaaaggccttggcaaattatatgatggtgctgttggcatggataattttgagagcta
tcctgagaaatggatcggttggaatagagaaaaacgtggagcaactattacaattgaagt
attgtttgcaaagaagaaaattatcaatgccattttatttcatgtgtcaaatttcttgaa
aagtggagctcagcgtacgtcacctaatgcttattgtatgaccaatgacaacatgcaaaa
ttcgttattggaaaaacttcacgctaatcagtcttcaggtagtgaatatgctgagccaaa
ctacatcagcaatgatatggaaattatcggagttaacaatacaaccatatgcgatcccac
aaaatctcttaccaattccacaattcattatgcttcaaatgatgtttgtatgcgacatcc
acgacaattaggatatgcgttaatggagaattcaatgacatctcaaatagctagcggtta
tgatacaaatagatcaacaaatttcgtcgaaattgattcaaaatgtctaagatttcatga
acatttgggtaatagtcgatttggtgagatttggctttgtcaattggaacagcgtacaat
ggtgaataaaacattccatagaagtcgtgataatcgaagagaatttgaaataattgtggg
tgaattaagtagtctaaggcatcaaaatatattagaagtgattggtgtctgcttcgatgg
tgtattaacaagctgtattcatgaatatatcgaacagtatcttgatcagtatcttcgaag
cctgaacaatgagatatcatacaggactgaactactactatcagtaagcacgcaaattgc
agctggaatgtcatatttggaatctaaaaatttcatccatggaaatctttcggcgagtaa
ttgtatggttgctaatgatggtaccgttaaactcaccaatttcaatatggcttatacatt
ggatcacttggaaacagatgatccaatagatcgtggacgaatgcggtggatgtcttggga
ggcagtcgcagaaaaaaaaattacaattaaaggcgatgtatggtcgttcggtgttacact
ttgggaagtccttaatggttgtcataaatatccttataaaatgatgactgataacgatgt
atatcgaaatttattatttatgcgacaaaatgggatgttaaagttctatttggaaaggcc
cgacttttcatctgtcaatttttaccaagaatttatactgccatgctggaacggtaattc
agaggaacgtcccacgtttcactcattacatcgtcgattgcaaaatgttacttgcgcaca
aatgagtgaagattgctactattga

DBGET integrated database retrieval system