KEGG   Brugia malayi (filaria): Bm1_27865Help
Entry
Bm1_27865         CDS       T01050                                 

Definition
Dual specificity mitogen-activated protein kinase kinase 7. -TRUNCATED-
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Bm1_27865
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_27865
   04012 ErbB signaling pathway
    Bm1_27865
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Bm1_27865
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Bm1_27865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 418 aa AA seqDB search
MLPTGRYSERKIHPTTDIFRLLNIVEFECRIRRWKQVRFAPLTRHVFASRRSSSVEPQVV
QVSRPFSNPSCSFPPQTNPLPRRIMVDGAPRRNLPELPTTISQSSPVSTADDALTKRLAE
IKRLSGRITIMKTMYETTKESLKRIGELGSGTCGVVYKARFEQTGTIMAVKQMVMTSVAE
ENKRVLMDLEVVLXSHDCPHIVRCYGCFITDFEVLICMELMATCLDKLSKRVQGGFPEDI
LGKMAVSIIKALDYLKVTQNIIHRDVKPSNILLDLNGTVKLCDFGIAGRLVDSMARTRTA
GCSAYMSPERLEAQDEYDVRADVWSIGISLVELAKGEYPYRGCNSEFEVLSRIVSDPAPV
LNPEEGFSPMFCDFLRLCLTKNYQFRPKYKELLQHEWVIHYETARVDVAGWYQRIVQS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccactggcagatacagcgagcgcaaaatacatccaacaaccgacattttccga
cttctaaatattgtagaatttgaatgtcgaatacggcgatggaagcaggtaagatttgct
cctcttacgagacatgtttttgcctcgcgtagatcatccagcgtagagccacaagtggta
caagtttcacgacctttctcgaatccaagctgctcatttccaccgcagaccaatccactt
ccacgacgaattatggttgatggagcacctcgtcgaaatcttccagaactaccaacaact
atttctcaatcttcacctgtcagtactgctgatgatgcgttgactaaacgtttagcagaa
attaaaagattgtcgggtcggataactattatgaaaactatgtatgaaacaacaaaagaa
agtctgaaaagaataggagaacttggttccggtacttgtggtgttgtttataaagcccga
ttcgaacaaacgggaacgattatggctgttaagcaaatggttatgacatcagtagcggaa
gagaacaagcgtgttttgatggatttagaagtggtacttygttcacatgattgcccgcat
attgtacgatgttacgggtgctttattactgattttgaagtactgatttgcatggaatta
atggcaacatgtctggataaactttccaaacgcgtgcagggtggttttccagaagatatc
cttggcaaaatggccgtttcaattataaaagctctggattatttaaaagttactcagaat
attattcatcgtgatgtaaaaccatcgaatattttgcttgatttaaatgggacagtgaaa
ttatgtgattttggtattgccggtcgtttagttgattcaatggctcgaacacgtactgcc
ggttgttctgcttatatgtcgccggaacgcttggaagctcaagacgaatatgatgttcgg
gctgacgtttggagtattggaatttcattggttgaattggccaaaggtgaatatccatat
cgtggttgtaacagtgaatttgaagtactttcacgaattgtttctgatccagcaccggtg
ctcaatcctgaagaaggattttctcctatgttctgtgattttctgcgtctttgccttaca
aagaattatcagtttcgaccaaagtacaaggaacttttacagcatgagtgggtaatacat
tatgaaactgcgagagtggatgttgctggttggtatcaaagaatcgtccagagttga

DBGET integrated database retrieval system