KEGG   Brugia malayi (filaria): Bm1_27925Help
Entry
Bm1_27925         CDS       T01050                                 

Definition
Laminin-like protein C54D1.5 precursor
Orthology
K05635  
laminin, gamma 1
Organism
bmy  Brugia malayi (filaria)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Bm1_27925
Cell adhesion molecules and their ligands [BR:bmy04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      Bm1_27925
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      Bm1_27925
     Laminin-2 Extracellular matrix (ECM) components
      Bm1_27925
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      Bm1_27925
   VLA-3
      Bm1_27925
     Laminin-10 Extracellular matrix (ECM) components
      Bm1_27925
     Laminin-11 Extracellular matrix (ECM) components
      Bm1_27925
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      Bm1_27925
     Laminin-8 Extracellular matrix (ECM) components
      Bm1_27925
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      Bm1_27925
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      Bm1_27925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1634 aa AA seqDB search
MEQYDELILHRQPCRTNLRVLQLIYILIWIIEIVLSQPAEQNPSIDPNHHIPGSSPCYXX
LNIPQRCVPDFINAAFNLQVEVTNTCGVNGPVSYCVQTGHSGVRKVCDICDSRVETYAHP
PAYLTDFNNANNETWWQSETMNEGMQYPNSINLTLRLGKTFDITYVRLKFVSPRPESFAI
FKKTHPDDDWIPWQYYSGSCRSTYGILEKAPILPSNEAVAQCTREFSDISPLTGGNIAFS
TLEGRPSSQNFEESETLQEWVTASEIRIMLTRMNTFGDEVFRDAKVLRSYYYAISDFAVG
GRCKCNGHASECVKSTGDGEDRLVCRCEHNTMGADCDQCLPFYNDRPWQVGTAKEANECI
TCNCSHLSNRCYFDQALFERTGSGGHCIDCAGNTQGAHCEECAPFNWRRPGEHYCIPCQC
NEIGSLSMQCDDHGQCPCKPGVDGHFCDRCMSGYYGFSISGCKNCLCDKTGSLNNEPVCD
SETGSCSCKLNVEGQQCNKCKPGYFDLSLDNQFGCTPCFCYGHSSICTSADGYYGMNVSS
NFDSGKEFWSAASLRGPEDIQWAEMDKAIAVSDIDGSPVYFVAPIQFTGDQRASYNQDLW
DILIVGQEGQELTIPIFAQENPIPSVNEQTYRFRIHANPVFQWSPRLNELDFIGILSNVS
ALKIRGTYSIEGDVGFLSNVHLGSAGLATSADEPREAHWIESCNCLEGFIGQFCESCAPG
YRREIKYGGLFDRCVKCECHGHSTSCAPESGECICEHNTTGDTCERCSRGYYGNALQGTP
DDCTKCPCPEDGPCVLHTDGDIICTDCPTGYTGRRCDVCADGFFGNPGEGKSCVECSCSG
NIDPNSIGNCDSLTGECKKCIYDTVGFNCEECKPGYWGDALLEPKGDCKACNCFAPGTKR
SNVDYVLLECRQSDGQCNCQPHVIGSRCDQCQPGYFNLTSGSGCQECNCDVLGSVNSTCD
VLTGQCLCKAGVMGRRCDQCEPQHYGFGLDGCQPCDCEVIGSESPQCDVITGQCLCRDHI
EGRRCDHCIENRYNLQAGCLPCDDCYTLTQSRVHAFRNDISVLEETLKEIVENPAPVDDV
EFDNYVKAVSAEVEDLANVVNKKLAGGDSQIIEQVNMLRSDLKNALKLLSSVDDIINKAN
KKATTIDETLKQWNLVKDRARSDLENALYYLETEGKTQWELAQEASRKYGEQSQQLSEIA
QEARKLAEQQENRSIEIEALAEKIANTSKQALVEAKEVIFGGDATSKEIAIMMERLNATE
KLLNQTRKLAEEQLTEADRAYKAAAESLTVVEGLRLPNIDPQQIEEEAKRVAEDAKATAD
NAKEQAAANKELIDEAVRLIAEAKYELQRVQDQQKVSDELLADVDAAKARAMEAVSLAEN
TLTEAQHTLEILNDFQERVDATKSEAIEELRNLKEIEKEIALAEETTREAENAIGNAKND
ARMAEKIALQAEKEAKSISKEAYELRNQTQYVRKTAEQLKSDANQLVSDVKETSTTMEDY
RRQASSDKARASEAVQKAQLAEKAAEDANKTISEAQDSLRSIINQLNSLDGVNIEELDEL
EKQLDQAEELLNSADLDKQVSLLKEQKIEQDRTITQFRNEIDTLKDEVQNLEEIRDSLPN
KCFNVINLEQEGHK
NT seq 4905 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatacgatgaattaatactgcatcgccagccatgtaggacaaatttaagagta
ctacaattaatatacattctaatttggataattgaaatagtactgtcacaaccagcggag
cagaatccatcaattgatccgaatcatcatattccaggaagtagtccatgttacgawkam
ttgaatattccacagcgatgtgtaccagatttcatcaacgctgcattcaatcttcaggtt
gaagtaactaatacgtgtggtgttaatggacctgtaagttattgtgtacaaacaggtcac
agtggcgtacgtaaagtttgtgatatctgtgatagcagggttgagacatatgctcatcct
cccgcttatttgactgattttaacaatgctaataatgaaacctggtggcaatcggaaacg
atgaacgaaggtatgcaatatccaaatagcatcaatttaacattacgccttggaaaaaca
ttcgatatcacttatgtcagattgaaatttgtcagtccaagaccagaaagttttgcaatt
tttaagaaaactcaccctgatgatgactggattccatggcagtattacagtggatcatgt
cgttcaacatatggaatactcgagaaagcaccgattttaccgagtaatgaagctgtagca
cagtgtacacgggaattctctgatatttctccattaactggcggtaatatcgcattttca
acactggaaggtagacctagcagtcaaaatttcgaggagagtgaaacactgcaggaatgg
gtgacagcatctgaaatacggatcatgttgacacggatgaatacatttggcgatgaagtg
ttccgggatgcaaaagtcttacgatcatattactatgctatatctgatttcgctgttggt
ggaaggtgtaaatgtaacggacacgcgagtgaatgcgtgaagtcaacaggtgatggtgaa
gatcgtttggtatgtcggtgtgagcacaatactatgggcgctgattgtgaccaatgctta
cctttttacaacgatcgaccttggcaggttggaactgcaaaagaggcaaatgaatgcatt
acttgcaactgcagtcatttatcaaatcgttgctattttgatcaagcattattcgaacgt
actggtagtggtggacattgtattgattgtgctggcaatacgcagggagcgcactgcgaa
gaatgcgcaccttttaattggcgtcgtcctggtgaacattactgtattccatgccaatgt
aacgaaattggatcactgagcatgcaatgcgatgaccatggtcagtgtccatgcaaacct
ggagtggatggtcatttctgtgaccgttgcatgagtggatattatggattctcgattagt
ggatgcaagaattgtttatgcgataagacagggtcattgaataatgaaccagtatgtgat
tcggaaacaggtagttgtagctgcaaattaaatgtagaaggacagcagtgtaataaatgc
aagcctggatattttgatttgtcgttggacaatcagttcggttgtacgccatgtttctgc
tatggtcactcgtctatctgcaccagcgcagatggctattatggaatgaatgtgagcagt
aactttgatagtgggaaagaattttggagtgctgcgtcattacgtggaccagaagatatt
cagtgggctgaaatggataaagctatcgctgtttccgatattgatggatcaccagtttat
ttcgtagcaccgatacaatttaccggagatcagcgagcatcatataatcaagacttatgg
gacatattaattgttggtcaagaaggccaggagttaaccataccaatttttgctcaagaa
aatccaattccatctgtaaatgagcaaacatatcgtttccggattcatgcaaatccggta
tttcagtggagtccacgattgaatgagttggattttattgggattctttccaacgttagc
gctctcaaaattcgtggaacttattcaattgaaggtgatgttggttttctgagtaatgtt
cacttggggtcagctggtttggctacttctgctgatgaaccacgtgaagcgcattggatc
gaatcgtgtaactgcttagaaggtttcattggacagttctgtgaatcatgcgctcccgga
tatcgtcgcgaaataaaatatggtggtctattcgaccgatgtgttaaatgcgaatgtcat
ggacattctacttcatgtgcgccagaatcaggtgagtgtatctgtgaacataataccaca
ggtgatacatgcgaacgttgcagtcgtggttattacggaaatgcactgcaaggtacgccg
gatgattgtactaaatgtccttgtccagaagatggtccctgtgtcttgcatactgatggc
gatattatttgcactgattgtccaaccggatatactggccgaagatgtgatgtttgtgcc
gatggtttctttggtaatccgggcgaggggaaatcatgtgtggaatgttcgtgtagcgga
aacatcgatcctaatagtatcggaaattgtgactcattgactggtgaatgcaaaaagtgc
atttatgatacagttggcttcaactgtgaggagtgcaagccaggctactggggtgatgca
cttttggagccaaaaggagattgcaaagcgtgcaactgctttgcacctggtactaaacgt
tccaacgtagattacgttctgcttgaatgccgacaaagtgacggtcaatgtaactgtcaa
ccgcacgtgatcgggtcacgctgtgatcagtgccagcctggatacttcaatttaacatcc
ggaagtggctgccaagaatgtaattgtgacgtacttggtagtgtcaacagcacctgtgac
gtgttaaccgggcaatgcttgtgtaaagctggggtgatgggccgcagatgtgatcaatgt
gaaccacaacattacggttttgggttagatggttgtcaaccgtgcgactgcgaagttatt
ggatccgaatcacctcaatgcgatgttatcactggccagtgtttatgtcgtgatcatatc
gaaggacgacgttgcgatcactgtattgaaaatcgttataatcttcaagctggttgttta
ccgtgtgatgattgctatacattgacacaaagtcgagtacatgcattcaggaatgatatc
agtgtgctggaagaaactctaaaagaaattgtcgagaatcctgcaccggttgacgacgtg
gaattcgataattatgtcaaagccgtcagtgctgaagtagaagatttggctaatgttgta
aacaaaaaattggctggtggggattcgcagattatcgaacaagtaaatatgcttaggagc
gatttgaagaatgcattgaaattgctaagctcggttgatgatattatcaataaagcaaat
aaaaaggccactacgatagacgaaacattgaagcaatggaatctagtcaaggatcgagca
cgaagtgatttagaaaatgcgttgtattatttggaaactgaaggaaaaacgcaatgggaa
ttggcgcaggaagcatctcgaaaatatggtgaacaaagccagcaattatcggaaatagcg
caagaagcaagaaaattagctgaacagcaagaaaatcgcagtattgaaattgaagcatta
gctgagaaaattgcaaatacctctaagcaggcacttgttgaagcgaaagaagtgatcttt
ggaggtgatgctactagcaaagaaattgcaattatgatggaacgtttaaatgcaaccgaa
aaactgctgaatcaaactcgtaaacttgctgaggaacaattaacagaagcagatcgtgca
tacaaagcagctgcagaaagtttaacagttgttgagggtttgcggttaccgaatattgat
ccacaacaaatcgaagaagaagcgaaacgagtcgcagaggatgctaaagctactgctgat
aatgctaaggaacaggcagctgctaataaagaactaatagatgaagcagtacgattaatt
gctgaagcaaaatatgaattgcaaagggttcaggatcaacaaaaagtttcggatgaactg
ctggctgacgtagatgctgcaaaagctcgtgctatggaggctgtttcgcttgctgaaaat
acattaacggaagcacaacatacgctagaaatactgaatgattttcaagaacgagtagat
gcaactaaatcagaagcaatcgaagaactgagaaatctgaaagagattgaaaaagaaatt
gctttagccgaggaaacaactcgagaagctgaaaatgctatcggtaatgccaaaaatgac
gcacggatggctgaaaaaattgctttacaagctgaaaaagaagctaaaagcatcagcaag
gaggcatacgaattacggaatcagacgcaatatgttcgtaaaactgcagaacaattaaaa
tcagatgctaaccaattggtcagtgatgtcaaggagacaagtacaacgatggaggattac
agacgacaggctagtagtgataaagctcgtgcttctgaggcagttcaaaaagctcaactt
gcggagaaagctgctgaagatgcgaataaaactatcagtgaggcgcaggatagcctaaga
agtattattaaccaactcaattccttagatggtgtgaatattgaagaattggatgaactg
gaaaaacaattggatcaagctgaagaattgttaaacagtgctgatttagataaacaggta
tcattgctcaaagaacaaaaaattgagcaggatcgcacaataacgcagtttagaaatgaa
atcgatactttaaaagacgaagtgcaaaatcttgaagaaatacgtgattcattgccgaac
aaatgtttcaatgtaattaatttggaacaagagggacacaaatag

DBGET integrated database retrieval system