KEGG   Brugia malayi (filaria): Bm1_28235Help
Entry
Bm1_28235         CDS       T01050                                 

Definition
Cytochrome c type-1
Orthology
K08738  
cytochrome c
Organism
bmy  Brugia malayi (filaria)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bm1_28235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 108 aa AA seqDB search
MSIPEGDYERGKKLFKMRCLQCHVIDSDANKNGPTLKGVIGRKSGTVDGYPYSSANKNKG
VVWTRETLFEYLLDPKKYIPGTKMVFAGLKKPQERADLIKFIEEESAK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattccggaaggtgattacgaaagaggcaaaaagttattcaaaatgcgatgcctt
cagtgtcatgtaatcgattcagatgcaaataaaaatggtccaactttgaaaggtgtgatt
gggcgtaaatcgggaactgtcgatggttacccatattcttctgccaataaaaataagggc
gtggtttggacacgtgaaacgctatttgaatatttattagatccgaaaaaatatattccg
ggaacgaagatggtatttgcaggcctaaagaaacctcaagaacgtgctgatttgatcaaa
tttatagaagaagaatctgcgaaataa

DBGET integrated database retrieval system