KEGG   Brugia malayi (filaria): Bm1_28235Help
Entry
Bm1_28235         CDS       T01050                                 

Definition
(RefSeq) Cytochrome c type-1
  KO
K08738  cytochrome c
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00920  Sulfur metabolism
bmy01100  Metabolic pathways
bmy04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bm1_28235
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    Bm1_28235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 6100543
NCBI-ProteinID: XP_001897096
UniProt: A0A0K0J057
AA seq 108 aa AA seqDB search
MSIPEGDYERGKKLFKMRCLQCHVIDSDANKNGPTLKGVIGRKSGTVDGYPYSSANKNKG
VVWTRETLFEYLLDPKKYIPGTKMVFAGLKKPQERADLIKFIEEESAK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattccggaaggtgattacgaaagaggcaaaaagttattcaaaatgcgatgcctt
cagtgtcatgtaatcgattcagatgcaaataaaaatggtccaactttgaaaggtgtgatt
gggcgtaaatcgggaactgtcgatggttacccatattcttctgccaataaaaataagggc
gtggtttggacacgtgaaacgctatttgaatatttattagatccgaaaaaatatattccg
ggaacgaagatggtatttgcaggcctaaagaaacctcaagaacgtgctgatttgatcaaa
tttatagaagaagaatctgcgaaataa

DBGET integrated database retrieval system