KEGG   Brugia malayi (filaria): Bm1_28765Help
Entry
Bm1_28765         CDS       T01050                                 

Definition
(RefSeq) ubiquitin specific protease 14
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Bm1_28765
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Bm1_28765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 168 aa AA seqDB search
MVRFFYKEKDKVNAKILKDVKFPLILDLYDMCTPELQQELLPARDAFKEEEDKKVEKLRA
TKTSDEITHPSRPDEDEKIEKAFPFSFSNDPGSNNSGYYELQGVITHKGRSSSSGHYVAW
VRVKENHWAMCDDDEVHPVSTEDILKLSGGGDWHCAYVLLYGPRILKK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggttcggtttttctacaaggaaaaggataaggtcaatgcaaagattttaaaagacgtt
aaatttcccctcattctcgatttgtacgacatgtgcactcccgaattacagcaggagtta
ttgccggcacgggatgcttttaaagaggaggaggacaaaaaagttgaaaaactaagagca
acaaaaacttctgatgagataactcatccttccagaccggatgaggatgagaaaatcgaa
aaagcttttccttttagttttagtaatgatcctggatcaaataatagtggatattatgaa
ttgcaaggagttataacacacaaaggtcgttcatccagtagtggacattatgtcgcatgg
gttcgcgtgaaagaaaatcattgggcaatgtgtgacgatgatgaagtacatccagtcagt
acagaagatattttgaagttatcaggtggtggtgattggcactgtgcatacgtgttactt
tatggtccaagaatattgaagaaataa

DBGET integrated database retrieval system