KEGG   Brugia malayi (filaria): Bm1_28765Help
Entry
Bm1_28765         CDS       T01050                                 

Definition
ubiquitin specific protease 14
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 168 aa AA seqDB search
MVRFFYKEKDKVNAKILKDVKFPLILDLYDMCTPELQQELLPARDAFKEEEDKKVEKLRA
TKTSDEITHPSRPDEDEKIEKAFPFSFSNDPGSNNSGYYELQGVITHKGRSSSSGHYVAW
VRVKENHWAMCDDDEVHPVSTEDILKLSGGGDWHCAYVLLYGPRILKK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggttcggtttttctacaaggaaaaggataaggtcaatgcaaagattttaaaagacgtt
aaatttcccctcattctcgatttgtacgacatgtgcactcccgaattacagcaggagtta
ttgccggcacgggatgcttttaaagaggaggaggacaaaaaagttgaaaaactaagagca
acaaaaacttctgatgagataactcatccttccagaccggatgaggatgagaaaatcgaa
aaagcttttccttttagttttagtaatgatcctggatcaaataatagtggatattatgaa
ttgcaaggagttataacacacaaaggtcgttcatccagtagtggacattatgtcgcatgg
gttcgcgtgaaagaaaatcattgggcaatgtgtgacgatgatgaagtacatccagtcagt
acagaagatattttgaagttatcaggtggtggtgattggcactgtgcatacgtgttactt
tatggtccaagaatattgaagaaataa

DBGET integrated database retrieval system