KEGG   Brugia malayi (filaria): Bm1_28810Help
Entry
Bm1_28810         CDS       T01050                                 

Definition
adaptor-related protein complex 2, beta 1 subunit, putative
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
bmy  Brugia malayi (filaria)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Bm1_28810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 953 aa AA seqDB search
MTDSKYFTTTKKGEIFELKNELNSDKKEKKREAVKKVIASMTVGKDVSALFPDVVNCMQT
DNVELKKLVYLYLMNYAKSQPDLAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCMKDEDPYVRKTAAVCVAKLHDINASLVEDQGFVELLNDLLSDSNPMVVANA
VAALAEINESHVLIEINSQTINKLLTALNECTEWGQVFILDALSSYQPKDEREAQNICER
ISPRLAHANAAVVLSTVKVLMKLVEMLPESSEFIGQLTKKLAPPMVTLLSAEPEIQYVAL
RNINLIVQKRPEILKQEMKVFFVKYNDPIYVKMEKLDIMIRLAQQNNINQVLSELKEYAT
EVDVDFVRKAVRAIGRCAIKVEQSAEKCVSTLLDLIQTKVNYVVQEAVVVIKDIFRKYPN
KYESIISTLCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFVEGFHDENTQVQLQ
LLTAVVKLFLKRPSETQQLVQRVLSLTTQDSDNPDLRDRGYIYWRLLSADPAAAKEVVLA
EKPLISEETDLLEPSLLDQLVCHIGSLASVYHKPPSSFVDITKHPLKTTDATTGTTHHAM
AEAGDSTNRPSVTTDTAQAPTVIPSQDTLIANLLSLDLSVPTTGATAHGMDSYQPAPMSS
GLDDLLGLGSDGLLGDIGGTSSSPTIPAQASLPQXNTGGIFGAPXPVSIPPAPTFPFAQT
AVPSTGLPXSAPITTAVSNPFTNLNDLFGGPVMGAPLLSGQTGYVAPKTASFSNLVWLEA
SKGKGTQIEGTFVRRGGQIYMDMVFTNRAMQPFSGFAIQFNKNSFGLIPAQPLQISSPLY
PNQSVQTSLPCHTNGPVQKMEPLTNLQVAIKNDVGVFYFATIVPLNMYFDESGQMDKRDF
LQMWKEIPEQNEVQFAINNVKGLSAADYFFMKLKEFDNKFMQIFMCRSNTEIA
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcaaaatatttcacaaccaccaaaaaaggtgaaatatttgaactgaaaaat
gaattgaattcggacaagaaggaaaagaaaagagaagcagtgaagaaagttattgcaagt
atgactgtcggtaaagatgtcagcgcactatttccggatgtggtgaattgtatgcaaacg
gacaatgttgagctgaagaagctagtttatctctatttgatgaattatgccaaaagtcaa
ccagatcttgcaattatggcggttaatacatttgtgaaagattgtgaggatccaaatccg
cttattcgagcattagctgtacggacgatgggttgtatacgagttgataaaataacggaa
tatttatgtgaaccattgcgaaaatgcatgaaggatgaggatccatacgttcgcaagact
gcagcagtctgcgtagcaaaaytgcatgatatcaacgcatcacttgtggaggatcaagga
ttcgtcgagttacttaatgatttgctgagtgattcaaatcctatggtagtagcaaatgca
gtagcagcgttagcagaaatcaatgaatcacacgtccttatcgagatcaactcacaaacc
ataaataagttactaacagcattaaatgaatgcacggaatggggacaagtgtttattctg
gatgctctttcatcatatcaaccaaaagatgaacgtgaagcacaaaacatctgtgagcgt
ataagtcctcgtctagctcatgcaaatgctgccgttgttttgtcaactgtgaaagttctc
atgaaattagtggaaatgctaccagaaagttcagaattcattggacagttaacaaagaaa
cttgcaccaccaatggttacactgctctctgctgaacctgaaattcagtatgtagcattg
cggaatatcaatttgatagtgcagaaaagaccagaaatattgaaacaagaaatgaaggtg
ttcttcgtgaaatacaacgatccaatctatgtaaaaatggagaagcttgatatcatgatt
cgtcttgcacagcaaaataatatcaaccaagtattaagcgagctgaaagagtatgcgaca
gaagtggatgttgattttgtgagaaaagcagttcgtgcaatcggtcgttgtgcaattaaa
gtagagcaaagtgctgagaaatgtgttagcacactgttggatttaattcaaactaaagtg
aattatgttgttcaggaagctgttgttgttattaaggacatttttcgtaaatatccaaat
aaatatgagagtataatttctacgctttgtgaaaacttggatacattggatgaaccggaa
gctcgtgcatcgatgatttggataattggagagtatgccgagcgtatagataatgcggat
gaactactagaatcttttgttgaaggttttcatgatgaaaatacgcaggttcaactgcag
cttcttacggcggtagttaagctatttttgaaacggccgagtgaaacacaacagcttgtt
cagcgagtattatctttgacaactcaagatagtgataatccagatttgcgtgatcgtgga
tatatttattggcgtctattaagtgctgatcctgctgctgcaaaagaggtggtgctagct
gaaaaacctcttatttcggaggaaacagatttgctggagccatcattgttggatcaactt
gtttgtcacattggttcactagcatctgtgtaccataaaccaccatcatctttcgttgat
atcacaaaacatcctctaaaaaccacagatgctacaacaggaacaactcatcatgctatg
gcagaagctggtgattcgacgaatcgaccaagtgttacaacggatacagcacaagcgcca
acagtaataccatctcaggatacattaattgctaatcttttatcgcttgatttgtcggta
ccaactactggtgccactgcacatggtatggactcgtatcaaccagcaccgatgtcttcc
ggtctggatgacttgttaggtcttggatctgatggattgctcggtgatattggcgggaca
agttcatcacctacaataccagctcaagcatcacttcctcagrcaaatactggagggatt
tttggtgctcccrcaccagtatctatccctcctgcacctacatttccttttgcgcagaca
gcagttccatcaaccggtttaccaycatcggctccaatcactactgccgtttccaatcca
tttaccaatttgaatgacctttttggtggacctgtaatgggtgcrccacttctctctggt
caracgggatatgtagcgccaaaaactgcaagcttttcaaatcttgtttggttggaggct
agtaaaggtaagggcacacaaattgaaggaactttcgttcgtcgtggtggacaaatttac
atggatatggtctttacgaaccgcgcaatgcagccttttagtggatttgctattcaattt
aacaagaattcgtttggtttaattccagcgcaaccacttcaaataagttcaccactttac
cctaatcaatcagtacagacatcacttccatgccatacaaatggtccagtgcagaaaatg
gaacctcttactaatttacaggtggctataaaaaatgatgttggtgtgttctattttgca
accatcgtaccgttaaacatgtattttgatgaaagtggtcagatggataagcgagatttc
ttacaaatgtggaaagaaataccggaacagaatgaagtacaatttgccatcaataatgtt
aaaggtcttagtgcagctgattatttcttcatgaaattgaaagaattcgataataaattc
atgcaaatctttatgtgtcgctcaaacacagaaattgcatag

DBGET integrated database retrieval system