KEGG   Brugia malayi (filaria): Bm1_29130Help
Entry
Bm1_29130         CDS       T01050                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00010  Glycolysis / Gluconeogenesis
bmy00051  Fructose and mannose metabolism
bmy00562  Inositol phosphate metabolism
bmy01100  Metabolic pathways
bmy01200  Carbon metabolism
bmy01230  Biosynthesis of amino acids
Module
bmy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmy_M00002  Glycolysis, core module involving three-carbon compounds
bmy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_29130
   00051 Fructose and mannose metabolism
    Bm1_29130
   00562 Inositol phosphate metabolism
    Bm1_29130
Enzymes [BR:bmy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bm1_29130
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bm1_29130
  Exosomal proteins of bladder cancer cells
   Bm1_29130
  Exosomal proteins of melanoma cells
   Bm1_29130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM YadA_stalk
Motif
Other DBs
NCBI-GeneID: 6100722
NCBI-ProteinID: XP_001897269
UniProt: A0A0J9YA50
AA seq 247 aa AA seqDB search
MSRKFLVGGNWKMNGNKASVDNIIKFLNDGAVVPNVDVVVAPPAPYLSYVKEKVKNGIEV
SAQNCYKVEKGAFTGEISPAMIKDLGLHWVILGHSERRHIFGESDELIAEKVLHAVDSGL
QTIFCCGEKLDEREAGKTKAVNFRQLQAVIDKKANWNKIVIAYEPVWAIGTGKTASPEQA
QEVHGWIREFLKEKVSADVAQKTRILYGGSVTAENAAELAKKPDIDGFLVGGASLKPDFI
KIIHARD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaaaatttcttgttggtggaaattggaaaatgaatggcaataaggccagtgtt
gataatattatcaaatttttgaatgatggagccgtggtaccaaatgtggatgttgtcgtt
gcaccacctgcaccttatttatcatatgttaaggagaaagttaagaatggcattgaagta
tcagcacaaaattgctataaggttgaaaaaggtgcatttactggtgaaatttctccagca
atgatcaaagatttaggactgcattgggttattttgggacattccgaacgacgtcatatt
tttggtgaatcggatgagctaattgcggaaaaagttttgcatgcagtcgacagtggtcta
caaacaatcttttgttgtggtgaaaaattggatgagcgagaagctggaaaaacaaaagct
gtgaactttcgacagcttcaagcggtcattgataagaaggcgaactggaataaaattgta
atagcttatgaacctgtctgggcaattggtactggtaaaacagcttcaccagaacaagct
caagaagtacatggttggattcgagaattcctgaaagaaaaagtgtctgcggatgtagct
cagaaaacgcgtattctttatggaggatcggtaacagctgaaaatgcggctgagctagcg
aaaaagccggatattgatggtttcttggttggtggagcttcattgaagcctgatttcatc
aaaattattcatgcacgtgattaa

DBGET integrated database retrieval system