KEGG   Brugia malayi (filaria): Bm1_29130Help
Entry
Bm1_29130         CDS       T01050                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_29130
   01230 Biosynthesis of amino acids
    Bm1_29130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_29130
   00051 Fructose and mannose metabolism
    Bm1_29130
   00562 Inositol phosphate metabolism
    Bm1_29130
Enzymes [BR:bmy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bm1_29130
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bm1_29130
  Exosomal proteins of bladder cancer cells
   Bm1_29130
  Exosomal proteins of melanoma cells
   Bm1_29130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MSRKFLVGGNWKMNGNKASVDNIIKFLNDGAVVPNVDVVVAPPAPYLSYVKEKVKNGIEV
SAQNCYKVEKGAFTGEISPAMIKDLGLHWVILGHSERRHIFGESDELIAEKVLHAVDSGL
QTIFCCGEKLDEREAGKTKAVNFRQLQAVIDKKANWNKIVIAYEPVWAIGTGKTASPEQA
QEVHGWIREFLKEKVSADVAQKTRILYGGSVTAENAAELAKKPDIDGFLVGGASLKPDFI
KIIHARD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaaaatttcttgttggtggaaattggaaaatgaatggcaataaggccagtgtt
gataatattatcaaatttttgaatgatggagccgtggtaccaaatgtggatgttgtcgtt
gcaccacctgcaccttatttatcatatgttaaggagaaagttaagaatggcattgaagta
tcagcacaaaattgctataaggttgaaaaaggtgcatttactggtgaaatttctccagca
atgatcaaagatttaggactgcattgggttattttgggacattccgaacgacgtcatatt
tttggtgaatcggatgagctaattgcggaaaaagttttgcatgcagtcgacagtggtcta
caaacaatcttttgttgtggtgaaaaattggatgagcgagaagctggaaaaacaaaagct
gtgaactttcgacagcttcaagcggtcattgataagaaggcgaactggaataaaattgta
atagcttatgaacctgtctgggcaattggtactggtaaaacagcttcaccagaacaagct
caagaagtacatggttggattcgagaattcctgaaagaaaaagtgtctgcggatgtagct
cagaaaacgcgtattctttatggaggatcggtaacagctgaaaatgcggctgagctagcg
aaaaagccggatattgatggtttcttggttggtggagcttcattgaagcctgatttcatc
aaaattattcatgcacgtgattaa

DBGET integrated database retrieval system