KEGG   Brugia malayi (filaria): Bm1_29130Help
Entry
Bm1_29130         CDS       T01050                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bmy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmy00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bmy00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bmy00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MSRKFLVGGNWKMNGNKASVDNIIKFLNDGAVVPNVDVVVAPPAPYLSYVKEKVKNGIEV
SAQNCYKVEKGAFTGEISPAMIKDLGLHWVILGHSERRHIFGESDELIAEKVLHAVDSGL
QTIFCCGEKLDEREAGKTKAVNFRQLQAVIDKKANWNKIVIAYEPVWAIGTGKTASPEQA
QEVHGWIREFLKEKVSADVAQKTRILYGGSVTAENAAELAKKPDIDGFLVGGASLKPDFI
KIIHARD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaaaatttcttgttggtggaaattggaaaatgaatggcaataaggccagtgtt
gataatattatcaaatttttgaatgatggagccgtggtaccaaatgtggatgttgtcgtt
gcaccacctgcaccttatttatcatatgttaaggagaaagttaagaatggcattgaagta
tcagcacaaaattgctataaggttgaaaaaggtgcatttactggtgaaatttctccagca
atgatcaaagatttaggactgcattgggttattttgggacattccgaacgacgtcatatt
tttggtgaatcggatgagctaattgcggaaaaagttttgcatgcagtcgacagtggtcta
caaacaatcttttgttgtggtgaaaaattggatgagcgagaagctggaaaaacaaaagct
gtgaactttcgacagcttcaagcggtcattgataagaaggcgaactggaataaaattgta
atagcttatgaacctgtctgggcaattggtactggtaaaacagcttcaccagaacaagct
caagaagtacatggttggattcgagaattcctgaaagaaaaagtgtctgcggatgtagct
cagaaaacgcgtattctttatggaggatcggtaacagctgaaaatgcggctgagctagcg
aaaaagccggatattgatggtttcttggttggtggagcttcattgaagcctgatttcatc
aaaattattcatgcacgtgattaa

DBGET integrated database retrieval system