KEGG   Brugia malayi (filaria): Bm1_29400Help
Entry
Bm1_29400         CDS       T01050                                 

Definition
Inositol monophosphatase family protein
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
bmy  Brugia malayi (filaria)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bmy00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bmy00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bmy04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MYIRPKPANLATLIIIIFFFYLGYLIWEKEEHFPDVVIELHDLLSYVLLATELGGRAILD
VSDGGKLNAFKKAETDVGKPELLTRADLLSNQLIINVLKRYPGLRIISEEKEEKLNALDY
EKYMSQQQELYDDVKTIVDLFPSRKYLLSKLTVWVDPLDATQEFAEGLFEYVSVMLCIAL
DGIPIFGVIYRPFTGEKVYGLNEFGVVKGNGDKWDRMISKNNSKLIMVSRSHAGNVRDVA
LNAFFSKFNVEAAGGSGYKSLRLLNGTGELYIHKTAIKKWDTCAGDALLRSIGGLMLDFN
GDMLSYDPNDDYVLRNGLIAAAQYPFTYYQQLRQHLNSTSIKE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtatatccggccgaaacctgcaaatcttgctacacttatcatcataatatttttcttc
tacctgggatatctgatttgggaaaaagaagagcattttccggatgttgttattgagctc
catgatttactaagctatgtgcttctagctacagaactaggtggtcgtgctatcctagat
gttagtgatgggggaaagttaaatgcttttaaaaaagctgagacggatgttggtaaaccg
gaacttttgacgagagctgatttgctgtcaaatcaacttataatcaatgtcctgaaaaga
tatccaggtttaaggatcatttctgaagaaaaagaagaaaagctgaatgcactggattat
gaaaaatatatgtcacagcagcaggaactttatgatgatgtgaaaactattgttgattta
tttccatcaagaaaatatttgttatcaaagttaactgtttgggttgatccattggatgca
acgcaagagtttgcagaaggtctgtttgaatatgtttctgtaatgctttgcatagcattg
gatggcatacctatctttggtgtcatctatagaccgttcactggtgaaaaggtttatggt
ttaaatgaatttggggtcgtgaaaggaaatggtgataaatgggatcgtatgatttcgaag
aacaattcaaaattgataatggtttccagatcacatgccggtaatgtaagagacgtggca
ctgaatgccttcttttccaaatttaatgttgaagcagctggtggttctggttacaaatcg
ctgaggttgttgaatggcactggtgagctgtatatacacaagactgccattaaaaagtgg
gatacctgtgccggtgatgctttgcttcgatcgattggcggtttaatgcttgatttcaat
ggtgatatgttgagttacgatccaaatgatgattatgtcttacgaaatggtttaatagct
gctgcacagtatcctttcacttattatcaacagttgcgacaacatttgaacagcacttcg
attaaagaatag

DBGET integrated database retrieval system