KEGG   Brugia malayi (filaria): Bm1_29400Help
Entry
Bm1_29400         CDS       T01050                                 

Definition
Inositol monophosphatase family protein
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
bmy  Brugia malayi (filaria)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bm1_29400
  Energy metabolism
   00920 Sulfur metabolism
    Bm1_29400
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Bm1_29400
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Bm1_29400
    3.1.3.25  inositol-phosphate phosphatase
     Bm1_29400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MYIRPKPANLATLIIIIFFFYLGYLIWEKEEHFPDVVIELHDLLSYVLLATELGGRAILD
VSDGGKLNAFKKAETDVGKPELLTRADLLSNQLIINVLKRYPGLRIISEEKEEKLNALDY
EKYMSQQQELYDDVKTIVDLFPSRKYLLSKLTVWVDPLDATQEFAEGLFEYVSVMLCIAL
DGIPIFGVIYRPFTGEKVYGLNEFGVVKGNGDKWDRMISKNNSKLIMVSRSHAGNVRDVA
LNAFFSKFNVEAAGGSGYKSLRLLNGTGELYIHKTAIKKWDTCAGDALLRSIGGLMLDFN
GDMLSYDPNDDYVLRNGLIAAAQYPFTYYQQLRQHLNSTSIKE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtatatccggccgaaacctgcaaatcttgctacacttatcatcataatatttttcttc
tacctgggatatctgatttgggaaaaagaagagcattttccggatgttgttattgagctc
catgatttactaagctatgtgcttctagctacagaactaggtggtcgtgctatcctagat
gttagtgatgggggaaagttaaatgcttttaaaaaagctgagacggatgttggtaaaccg
gaacttttgacgagagctgatttgctgtcaaatcaacttataatcaatgtcctgaaaaga
tatccaggtttaaggatcatttctgaagaaaaagaagaaaagctgaatgcactggattat
gaaaaatatatgtcacagcagcaggaactttatgatgatgtgaaaactattgttgattta
tttccatcaagaaaatatttgttatcaaagttaactgtttgggttgatccattggatgca
acgcaagagtttgcagaaggtctgtttgaatatgtttctgtaatgctttgcatagcattg
gatggcatacctatctttggtgtcatctatagaccgttcactggtgaaaaggtttatggt
ttaaatgaatttggggtcgtgaaaggaaatggtgataaatgggatcgtatgatttcgaag
aacaattcaaaattgataatggtttccagatcacatgccggtaatgtaagagacgtggca
ctgaatgccttcttttccaaatttaatgttgaagcagctggtggttctggttacaaatcg
ctgaggttgttgaatggcactggtgagctgtatatacacaagactgccattaaaaagtgg
gatacctgtgccggtgatgctttgcttcgatcgattggcggtttaatgcttgatttcaat
ggtgatatgttgagttacgatccaaatgatgattatgtcttacgaaatggtttaatagct
gctgcacagtatcctttcacttattatcaacagttgcgacaacatttgaacagcacttcg
attaaagaatag

DBGET integrated database retrieval system