KEGG   Brugia malayi (filaria): Bm1_30205Help
Entry
Bm1_30205         CDS       T01050                                 

Definition
kinase, mitochondrial precursor
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MRLVRRLLQQFRGHMVVEKLKYYERFRPHPISLKMYLGFGQEGTVEISFKFLQKELLVRL
ANISKEIDSLLQNLPQLSSTTDVCKLFYQSFEDLLPFENAEPTDDNISSFNEKLETVMMR
HENTIEEMAEGIVQLRQKYGINITSNNKIQYFLDRFYFNTISIRILQHQHLIIFGTLLPA
SPRHIGCIDPACDVAAVIVDAYDSARFVCDGCYCDSPKLQFDSYNSVAPGHSIAIAAIPS
HLYHIMFELFKNSMRATVDHYGEFEKLPPIQVLATLGEEDLTVRISDSGGGIPRRKMNQL
FQYSYTTAPPPASGGHNAALAGYGYGLPLSRLYARYFHGDLMVTSMEGYGTDTFLYIKAV
PFKASETIPRYSTSSRNNSSPSPTVSQPSG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttggtaaggcgtttgttgcaacaatttcgaggtcatatggttgtggaaaaatta
aagtattatgaacgttttcgaccacatccgatatcattgaaaatgtatttgggttttgga
caggagggaactgtggaaatatcattcaaattcttacaaaaagaacttcttgttcgttta
gctaatatttcaaaggaaattgattcattacttcaaaatttacctcagttatcttctact
accgatgtatgtaaattattttaccaaagtttcgaagatttgttgccgtttgaaaatgct
gagccaacggatgataacatcagttcatttaatgagaaattggaaacagtgatgatgcga
cacgaaaataccatcgaagagatggccgaaggtattgttcagttacgacagaagtatggc
ataaatataacatcaaataataaaatccaatattttttggatcgattttattttaatacg
atatctatacgaattttgcagcatcagcatttgataatttttggaacattacttcctgcg
agtcctcgacatataggttgcattgatccagcatgtgatgttgctgcagttatcgtagac
gcctatgatagtgcccgatttgtgtgcgatgggtgttattgtgattcgcctaaactacaa
ttcgattcttataattcagttgcacctggacattcaatagctatcgcagctataccatct
catttatatcatatcatgtttgaattattcaaaaactcgatgcgtgccactgttgatcat
tacggtgaattcgaaaaacttcctcctattcaagtattggcaacattgggtgaagaagat
ttgactgttaggataagtgacagtggtggtggcattccgcgaagaaagatgaatcagttg
ttccagtacagctacactactgcaccaccaccagcaagtggcggtcataatgcagcatta
gcgggatatggttatggtcttcctctgtctcggctatacgctcgctattttcacggagat
ttaatggtcacttcgatggaaggctacggaaccgatacatttctatacattaaagcagta
ccatttaaagccagcgaaacgattccaaggtacagtacatcatcacgaaacaattcctcc
ccgtcgccgactgtttctcagccatcaggttga

DBGET integrated database retrieval system