KEGG   Brugia malayi (filaria): Bm1_30395Help
Entry
Bm1_30395         CDS       T01050                                 

Definition
Probable phospholipid hydroperoxide glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bmy00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bmy00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
MFRGMCSVLHKSTSGSIRSLVKMSXATTIYDFTVKDAEGKDVSLEKYRGKPVVIVNVASQ
CGLTNSNYTELKELMEHYKDKGLAIAAFPCNQFGGQEPKCELEVKNFVANKFHFEPDLYG
KIDVNGKNAAPLFDFLKHAKGGLFGDNIKWNFTKFLIDQEGHPVKRYAPTTSPKHMMKDI
DDLLKN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcgggatgtgctcagttttgcataaaagtactagtggtagtattcgttcgctt
gtraagatgtctkyagcaacmacaatttatgatttcactgtgaaagatgcagaaggaaaa
gatgtttcgctcgaaaaataccgaggtaaaccagtggtaattgtaaatgtcgcatcgcaa
tgtggtttgacaaattccaattataccgagcttaaagaactgatggaacattacaaggat
aaaggtttagcaatagctgcattcccgtgcaaccaatttggtggacaggaaccaaagtgt
gaattggaagtgaaaaattttgttgctaataaatttcatttcgaacctgatttatacggt
aaaattgatgtaaatggtaaaaatgctgcaccattattcgattttctgaagcatgccaaa
ggtggattgtttggtgacaacataaaatggaatttcacaaaatttctgattgaccaggaa
ggacatccggtgaagcgttatgcaccaacaacctcacccaaacatatgatgaaagatatc
gatgacctcctcaagaactga

DBGET integrated database retrieval system