KEGG   Brugia malayi (filaria): Bm1_30520Help
Entry
Bm1_30520         CDS       T01050                                 

Definition
Probable enoyl-CoA hydratase, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmy  Brugia malayi (filaria)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_30520
   01212 Fatty acid metabolism
    Bm1_30520
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bm1_30520
   00650 Butanoate metabolism
    Bm1_30520
  Lipid metabolism
   00062 Fatty acid elongation
    Bm1_30520
   00071 Fatty acid degradation
    Bm1_30520
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bm1_30520
   00310 Lysine degradation
    Bm1_30520
   00380 Tryptophan metabolism
    Bm1_30520
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bm1_30520
Enzymes [BR:bmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bm1_30520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MSKVIRNLWLLIGNSTRILSSFWGFQRCNFACKYKIILSRVTFIKKCYHYFFFDFSFRLY
LTLPFVLKVIYPLELSIAAAVPMIKTERVGEKMNVGLIKLDRPKALNALCNQLMQELSDA
LVEFDSDTSIGAVVITGDKRVFSMGADIKELCAIQYETKSSENILQNWTQISKMKKPIIA
AVNGHALGGGCELALMCDIIYAGEEAKFGQPEVIIGTIPGAGGTQRWLRVTGKSMAMEVC
LTGIPITAQEAKECGLISRIFPIDRVVLEAIKTAEKISGHSPLIVSFVKDAINSSYETFL
QEGLHYESRLFHTTFATNDQKEGMKAFLEXRKPKWTCS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagtgatacgaaatttatggttattaatcggtaattcaaccagaattttgtcg
agtttttggggtttccaacgatgtaactttgcttgtaagtacaaaataattctttcaaga
gtaacttttataaaaaaatgctatcattattttttttttgatttttcgtttcgcctatat
ctgactcttccgtttgtattgaaagttatttacccattggaattatccattgcagctgcg
gtacccatgatcaaaaccgaaagggtcggtgaaaaaatgaatgttggtttaattaagctt
gatagacctaaagcattaaatgcattatgcaatcagcttatgcaagagctttcagatgca
ctagttgaatttgacagtgatacttcaattggagcggtggtaataacaggtgataaacgt
gtattctcaatgggagccgatataaaagagttatgtgctattcaatatgaaacgaaatca
tctgaaaatatattgcaaaattggactcaaatatcgaagatgaagaaaccaattattgct
gctgtgaacggccatgcacttggtggtggttgtgaattagctctgatgtgtgatataatt
tatgctggagaggaagctaaatttggtcaaccagaggttattatcgggactataccaggt
gctggtggtactcaacgatggttgcgtgttacgggtaaatctatggcaatggaagtgtgt
ttaacaggaatacccataacagcacaggaagcaaaagaatgtggtttaatttcaagaata
tttcctattgaccgtgttgtattggaggctatcaagacagccgaaaaaattagtggacat
tcaccgctgatagtatcatttgtaaaagatgctattaatagttcctatgaaactttcctt
caggaaggccttcactatgaaagtcgactatttcataccacttttgcaacgaatgatcaa
aaagaaggtatgaaagcatttttggaaaawcgtaaaccaaaatggacatgttcatga

DBGET integrated database retrieval system