KEGG   Brugia malayi (filaria): Bm1_30560Help
Entry
Bm1_30560         CDS       T01050                                 

Definition
Protein kinase domain containing protein
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 857 aa AA seqDB search
MPRHGFDSLRRMPIVVIPRRRKYKNYVSRRRNTKLIASLRRCFSDPILYRSYNHWEDLSR
PFPPEKPSSSFAPSAHAAPIAAIPEASSFDDSAMTVEAKTRKEFASLQTSKRSKPKEEVL
FGGLAKSVVRKDEDMKVEFKDNGKLSKAFDLVMNKDGIAVNYSDHVIPDVNEEGESLVEV
VLRAPTPPTTSRIRPRNLASRSVVLSRTTTIETPLIKRRLLGCAKYHEGCDSGRKDYHRE
YVNLPSGSNLDEREEEKTAERKAQNTVTAVTAAFSTLTFEPQQNEQEREAIAEQASKAGA
TTVVGTRGAEGVRGGTSEVTIRSGVNKTEKRVVPVLQQTLNISSANNDNNSIGISGNSRQ
RKPRKMVPQSTGITVVQPSSIQKPKPPTKLFSHSSLLATLQLPASVRAKVDRIIANADRK
EKERYSNHAPINSSDRSDRLQPASSSKSHVTGAGQTPSSSVAPSVARPVVQDDRDGHLIY
QDGDIIQGRYEIVRTLGEGTFGKVVQVKDGTKGGRQFALKVIKNVSKYREAARLEINVLN
KLQEKDPSGKFLVIQLLDNFDYHGHVCLLFELLGLSVFDFMKANNYQAYPMEQARYIAYQ
LCYAVKFMHDNRLTHTDLKPENILFLNSSYRVVEDGKKKRPLRIIDDARVRLIDLGSATF
DHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMM
ERILGTLPYRMCRKSKTKYFYHGRLDWNEKTQAGQYVRDNCKPLSRYMKSNDPEDVELFD
IISEMLTYEPSQRITLGSALDHRYFKRLAPHLRLHESGASSNGSSTSSAAATTAAAAVVS
AQAIVISGASDGNGEER
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgccacgccatggttttgacagtctacggcgaatgccaattgtggtgattccacgaaga
aggaaatataaaaattatgtatctaggagacgtaatacgaagcttattgctagtctgcgt
cgatgtttctccgatccaatattgtaccgaagttacaatcattgggaagatctatcaagg
ccatttcctccagaaaaaccatcatcttcatttgcaccttctgctcatgcagcacccatt
gctgcaatacctgaagcgagttcctttgatgattcggcgatgacggttgaagctaaaacg
aggaaggagttcgcttcacttcagacgtcgaaaagatcaaaacccaaagaagaagtgttg
tttggtggattggcgaaatcagtagttcgaaaagatgaagatatgaaagtggaatttaaa
gataacggaaaattatcaaaagcatttgatttggtaatgaacaaagatggaatagctgtt
aattattcggatcatgttatcccagatgtgaatgaagagggagaaagtttggtagaagtt
gttttacgtgctcccactcccccaaccacctctaggatacgaccgcgtaatttggcttct
cgcagtgttgtgctatcaagaacaactaccatcgaaacaccgctcattaagcgacgtctc
ttaggttgtgcaaaatatcacgaaggttgtgatagcggtcggaaggattatcaccgagaa
tatgtcaatttaccatcaggaagtaatttagatgaaagagaagaggaaaaaacggccgaa
cgaaaggctcagaatacggttacagctgttacagctgctttttcaaccctaacatttgaa
ccacagcaaaatgagcaagaacgagaagctattgctgaacaagcaagtaaggcaggtgct
acaactgttgtcggaacaagaggtgcagaaggagttagaggaggaacaagtgaagttacg
ataagaagtggtgttaataaaacggagaaacgggttgtaccagtactacagcaaacgcta
aatataagctcagcaaataatgataataatagcatcggtattagtggtaacagtagacaa
cgaaaaccccgaaaaatggtaccacaatctaccgggattaccgtagtacaaccatcatcc
attcaaaagccaaaacctccaactaaattattttcgcatagttccttgcttgctaccctt
cagctaccagcatccgttagagcaaaggtggatcgaattattgcaaatgctgatcggaaa
gaaaaagaacgatattccaatcatgctcccattaattcgagtgatcgctctgatcgccta
caaccggcatcttcatcgaagtcacatgtaactggagctggacaaacgccatcaagttct
gttgcaccttcggtagcacgaccagtcgtacaggacgatcgtgatggccatcttatttat
caggatggtgatattattcaaggaagatatgaaatagtacgtacattaggtgaaggaaca
ttcggtaaggtggtgcaagttaaggatggtactaaaggtggtcgacagtttgcattaaag
gttatcaaaaatgtaagcaaatatcgcgaagctgcacgtcttgagattaatgtactaaac
aaattacaggagaaagatccgagtggaaaatttttggtcatacaactccttgataatttc
gattatcatggccatgtgtgcttattattcgaattacttggtcttagcgtttttgatttt
atgaaagcgaacaattatcaagcttatccaatggagcaagcgcggtatatagcttatcaa
ttatgctatgcggtaaaatttatgcacgataatcgtttaacgcacacggatctcaaaccc
gaaaatattttgtttctcaatagtagctacagagtggtcgaggatggaaagaaaaaaagg
cctttacgaataatcgatgatgcacgcgtacgattaattgatctcggctcagcaactttt
gatcatgaacatcattcgacaattgtttcaacaaggcattatcgagcacctgaagttatt
ctagaattaggttggtctcaaccatgtgatgtctggtcgattggttgcatcttgttcgag
ctctacctcggtatcacattatttcaaacgcacgataatagggaacatcttgcaatgatg
gaaagaattttgggtacattaccttatcgaatgtgcaggaagtccaaaacgaaatatttt
tatcacggacgattagactggaatgaaaaaacacaagcaggacagtacgttagagataat
tgtaaaccgttgtcgcgctatatgaagtcaaacgatccggaggacgttgaattatttgat
ataatctcagaaatgcttacatatgaaccatcgcaacgaataacgctgggttctgcatta
gatcatcggtatttcaaacgtttagcaccacatcttagactacacgaaagtggtgcttcg
tcgaatgggtcatccacatcatcagcagcggcgacaactgctgcagcagcggtagtatca
gctcaagcaatagtaatatctggtgcgagtgatggaaatggtgaagaacgatag

DBGET integrated database retrieval system