KEGG   Brugia malayi (filaria): Bm1_31220Help
Entry
Bm1_31220         CDS       T01050                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bmy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmy00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bmy00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bmy00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmy00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 849 aa AA seqDB search
MATQPESTPIPQRIVSSSTQLTTVPIAPFAEPAEANAAVQNDDDLGPLKEISVRRRHFSK
VRSDSIIPTEGHEGILIAPKLYKGQSIAVYTSGGDASGMNSAVRSVVRMGLYLGCRVYFI
YEGYQGMVDGGEYIKEAEWDSVSDIIQRGGTIIGSARCKDFRERPGRLRAAENLIKKQIT
HLVCIGGDGSLTGANLFRQEWPSLIQELFASGKISQQESESCKSIQIVGLVGSIDNDFCG
TDMTIGTDTALQRIIDAIDSVVSTAHSHQRTFVIEVMGRHCGYLALVAALASEADFCFIP
EWPVPVDWPIVLCHKLQVMRQEGSRLNIIIVAEGALDRDGKAITASQVQDVIKEKLHYDT
RVTVLGHVQRGGSPSAFDRLLGCRMGAEAVLALMEMTPASEPCVVSIDGNAIVRVPLMQC
VHRTQAVQKAMETHDWDTAVKLRGRSFQRNLETYRLLTKLEPKSNMPSNESSSYNVAVIN
VGAPAGGMNAVVRSFVRMGIYRRCKVYGVKNSFEGLANGDLKEMSWKDVNGWVMYGGSFL
GTQKQLPDKNMDQVAATLEKFKIHGLLIVGGFEAYHSCLMLSHARSQYSSLRIPLCVIPC
TISNNVPGTSISLGSDTAVNEICAVIDKIKQSATGTKKRVFIVETMGGFCGYLATLSALA
SGADNAYIFEEKFNVSDIIEDVKVIARKMRTGVQRYLIVRCELANKNYTTQFVNQLFSEE
GRGQFSTRINVLGHAQQGGNPAPFDRNMGTKLAANALEFILVQAKKYIDLSSGITSATAA
DSATLLGLKDRRMVFTPVEELAQETDFEHRLPKDQWWMRLRPLLRILAKHDSTYETEAFA
VTDVENELD
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaacccgaatcaactccgattccgcaacgtattgtttcatcttccacacaa
ctgacaacagtgccgattgcgccatttgcggaaccagctgaagcaaacgcagcagtacaa
aatgacgatgatctgggtcctctaaaggaaatatcagttcgtaggagacatttctcaaaa
gttcgatcagattccataattccaaccgaaggtcatgagggcattctaattgctccaaag
ctttataaaggacaatcgattgctgtctacacaagtggtggtgatgcttctggaatgaac
agtgcagtgcgatcagttgtccggatgggcctttaccttggttgtcgagtatatttcatt
tatgaaggttaccaaggtatggtggatggtggtgaatatatcaaggaagctgaatgggat
tctgtatcagacatcatccaaagaggcggtacaataattggctcggctcgctgcaaagat
tttcgtgaacgtccaggtcgacttcgtgctgctgaaaatctcatcaaaaagcaaattact
catttagtgtgcattggaggtgatggctcgctaacgggtgcaaatttattccgtcaagaa
tggccaagtttgattcaagaattgtttgcatctggaaaaataagtcaacaagaaagtgaa
tcgtgcaaaagtattcaaattgttggccttgtgggttccattgataatgatttttgtggg
accgatatgacgattggtaccgatactgcgcttcaacgaattattgatgctatcgattct
gtagtgtcaactgcgcacagccatcaacgtacttttgtcattgaggtgatgggccggcat
tgtggttatctggcacttgtagctgcattagcatcggaagcagatttctgttttattcct
gaatggccggtaccggtagattggccaatagtgttgtgtcataaattacaagtaatgcga
caggaaggatcacggttgaatattatcatagttgccgaaggggcactggatcgagatggt
aaggctattacagccagtcaggtacaagatgtaataaaagagaagctgcattatgataca
cgtgtaaccgtgctaggtcacgtccaacgtggtggaagtccatcagcttttgatcgactt
cttggatgtcgaatgggtgctgaagctgtgcttgcactcatggaaatgactccggcatca
gaaccctgtgtagtgtccatcgatggtaatgctattgttcgagtaccgctcatgcaatgt
gttcatcgtacccaagcagttcaaaaagcgatggaaacgcacgactgggacacagccgtg
aaactacggggacgaagctttcagagaaacctggaaacttatcgtctattaacaaaatta
gaacccaaaagcaatatgccatcgaatgagtcatcatcatacaacgtcgcagtcataaat
gttggagcacctgctggaggaatgaatgcagtagtgcgttcattcgttcgcatgggtatt
tatcgtcgctgtaaagtgtatggtgttaaaaattcatttgaagggctagcaaacggggat
ctaaaagaaatgtcgtggaaagatgtaaatggttgggtcatgtatggtgggtcattcttg
ggtactcagaaacaactaccggataaaaatatggaccaagttgcagcaacattagaaaaa
ttcaaaattcatggattattgattgtcggaggtttcgaggcttatcactcctgcttgatg
ctttcacatgctcgtagccaatattcatcacttcgtatcccactttgcgtaataccttgt
actatcagtaataacgtacccggtacatcgatttctttgggttccgacactgcagttaat
gaaatctgtgcagtgattgataaaattaagcagtctgcaacgggtaccaaaaaacgcgta
tttattgtggaaacaatgggcggattttgtggatatttggcgactctttcagctcttgca
tcaggagctgataatgcttatatatttgaagagaagttcaatgtcagcgatatcattgaa
gatgttaaggttattgcccgaaaaatgcgcactggtgtacaacggtatcttattgttcgt
tgtgaattggctaacaagaattatactacacaatttgttaatcaacttttttcggaagag
ggcagaggacagttctcaacaagaatcaatgtgctaggacatgcgcaacagggtggtaat
ccagcgccatttgatcgtaacatgggtacgaaacttgctgcaaacgctctagaatttatt
ttagttcaagcaaagaagtacattgatttgtcaagtggaataactagtgcaactgctgca
gacagcgctacacttctcggtctaaaggatcgaagaatggtatttacaccagttgaagaa
ttggctcaagagaccgattttgagcatcgcttaccgaaagatcagtggtggatgagacta
cggcctctgttgagaatattggctaagcatgattccacttatgaaacagaagcgtttgca
gttacagatgtcgagaatgaactcgactaa

DBGET integrated database retrieval system