KEGG   Brugia malayi (filaria): Bm1_31220Help
Entry
Bm1_31220         CDS       T01050                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_31220
   01230 Biosynthesis of amino acids
    Bm1_31220
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_31220
   00030 Pentose phosphate pathway
    Bm1_31220
   00051 Fructose and mannose metabolism
    Bm1_31220
   00052 Galactose metabolism
    Bm1_31220
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bm1_31220
Protein phosphatases and associated proteins [BR:bmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bm1_31220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 849 aa AA seqDB search
MATQPESTPIPQRIVSSSTQLTTVPIAPFAEPAEANAAVQNDDDLGPLKEISVRRRHFSK
VRSDSIIPTEGHEGILIAPKLYKGQSIAVYTSGGDASGMNSAVRSVVRMGLYLGCRVYFI
YEGYQGMVDGGEYIKEAEWDSVSDIIQRGGTIIGSARCKDFRERPGRLRAAENLIKKQIT
HLVCIGGDGSLTGANLFRQEWPSLIQELFASGKISQQESESCKSIQIVGLVGSIDNDFCG
TDMTIGTDTALQRIIDAIDSVVSTAHSHQRTFVIEVMGRHCGYLALVAALASEADFCFIP
EWPVPVDWPIVLCHKLQVMRQEGSRLNIIIVAEGALDRDGKAITASQVQDVIKEKLHYDT
RVTVLGHVQRGGSPSAFDRLLGCRMGAEAVLALMEMTPASEPCVVSIDGNAIVRVPLMQC
VHRTQAVQKAMETHDWDTAVKLRGRSFQRNLETYRLLTKLEPKSNMPSNESSSYNVAVIN
VGAPAGGMNAVVRSFVRMGIYRRCKVYGVKNSFEGLANGDLKEMSWKDVNGWVMYGGSFL
GTQKQLPDKNMDQVAATLEKFKIHGLLIVGGFEAYHSCLMLSHARSQYSSLRIPLCVIPC
TISNNVPGTSISLGSDTAVNEICAVIDKIKQSATGTKKRVFIVETMGGFCGYLATLSALA
SGADNAYIFEEKFNVSDIIEDVKVIARKMRTGVQRYLIVRCELANKNYTTQFVNQLFSEE
GRGQFSTRINVLGHAQQGGNPAPFDRNMGTKLAANALEFILVQAKKYIDLSSGITSATAA
DSATLLGLKDRRMVFTPVEELAQETDFEHRLPKDQWWMRLRPLLRILAKHDSTYETEAFA
VTDVENELD
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaacccgaatcaactccgattccgcaacgtattgtttcatcttccacacaa
ctgacaacagtgccgattgcgccatttgcggaaccagctgaagcaaacgcagcagtacaa
aatgacgatgatctgggtcctctaaaggaaatatcagttcgtaggagacatttctcaaaa
gttcgatcagattccataattccaaccgaaggtcatgagggcattctaattgctccaaag
ctttataaaggacaatcgattgctgtctacacaagtggtggtgatgcttctggaatgaac
agtgcagtgcgatcagttgtccggatgggcctttaccttggttgtcgagtatatttcatt
tatgaaggttaccaaggtatggtggatggtggtgaatatatcaaggaagctgaatgggat
tctgtatcagacatcatccaaagaggcggtacaataattggctcggctcgctgcaaagat
tttcgtgaacgtccaggtcgacttcgtgctgctgaaaatctcatcaaaaagcaaattact
catttagtgtgcattggaggtgatggctcgctaacgggtgcaaatttattccgtcaagaa
tggccaagtttgattcaagaattgtttgcatctggaaaaataagtcaacaagaaagtgaa
tcgtgcaaaagtattcaaattgttggccttgtgggttccattgataatgatttttgtggg
accgatatgacgattggtaccgatactgcgcttcaacgaattattgatgctatcgattct
gtagtgtcaactgcgcacagccatcaacgtacttttgtcattgaggtgatgggccggcat
tgtggttatctggcacttgtagctgcattagcatcggaagcagatttctgttttattcct
gaatggccggtaccggtagattggccaatagtgttgtgtcataaattacaagtaatgcga
caggaaggatcacggttgaatattatcatagttgccgaaggggcactggatcgagatggt
aaggctattacagccagtcaggtacaagatgtaataaaagagaagctgcattatgataca
cgtgtaaccgtgctaggtcacgtccaacgtggtggaagtccatcagcttttgatcgactt
cttggatgtcgaatgggtgctgaagctgtgcttgcactcatggaaatgactccggcatca
gaaccctgtgtagtgtccatcgatggtaatgctattgttcgagtaccgctcatgcaatgt
gttcatcgtacccaagcagttcaaaaagcgatggaaacgcacgactgggacacagccgtg
aaactacggggacgaagctttcagagaaacctggaaacttatcgtctattaacaaaatta
gaacccaaaagcaatatgccatcgaatgagtcatcatcatacaacgtcgcagtcataaat
gttggagcacctgctggaggaatgaatgcagtagtgcgttcattcgttcgcatgggtatt
tatcgtcgctgtaaagtgtatggtgttaaaaattcatttgaagggctagcaaacggggat
ctaaaagaaatgtcgtggaaagatgtaaatggttgggtcatgtatggtgggtcattcttg
ggtactcagaaacaactaccggataaaaatatggaccaagttgcagcaacattagaaaaa
ttcaaaattcatggattattgattgtcggaggtttcgaggcttatcactcctgcttgatg
ctttcacatgctcgtagccaatattcatcacttcgtatcccactttgcgtaataccttgt
actatcagtaataacgtacccggtacatcgatttctttgggttccgacactgcagttaat
gaaatctgtgcagtgattgataaaattaagcagtctgcaacgggtaccaaaaaacgcgta
tttattgtggaaacaatgggcggattttgtggatatttggcgactctttcagctcttgca
tcaggagctgataatgcttatatatttgaagagaagttcaatgtcagcgatatcattgaa
gatgttaaggttattgcccgaaaaatgcgcactggtgtacaacggtatcttattgttcgt
tgtgaattggctaacaagaattatactacacaatttgttaatcaacttttttcggaagag
ggcagaggacagttctcaacaagaatcaatgtgctaggacatgcgcaacagggtggtaat
ccagcgccatttgatcgtaacatgggtacgaaacttgctgcaaacgctctagaatttatt
ttagttcaagcaaagaagtacattgatttgtcaagtggaataactagtgcaactgctgca
gacagcgctacacttctcggtctaaaggatcgaagaatggtatttacaccagttgaagaa
ttggctcaagagaccgattttgagcatcgcttaccgaaagatcagtggtggatgagacta
cggcctctgttgagaatattggctaagcatgattccacttatgaaacagaagcgtttgca
gttacagatgtcgagaatgaactcgactaa

DBGET integrated database retrieval system