KEGG   Brugia malayi (filaria): Bm1_31785Help
Entry
Bm1_31785         CDS       T01050                                 

Definition
P38 map kinase family protein 2
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bmy04010]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bmy04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MELTRTLKPGFYAVELNKTVWIIPNCYQNLTPVGTGAYGTVCAAECRPTGEKVAIKKFSR
PFQSAIHAKRTHRELKLLRSMNHENIIDMLDVFTPDINATSLQDVYFVSMLMGADLSSIL
KIQRLSDDHIQFLVYQILRGLKYIHSAGLIHRDLKPSNIAVNEDCELKILDFGLARQTDS
EMTGYVATRWYRAPEIMLNWMHYTQTVDIWSVGCIMAELITGRTLFPGADHIDQLTRIMN
VVGTPNEEFLSKIQSDEARNYIRNLPKTPRKDFKRLFPSASPDAIDLLERTLNLDPDYRP
TASEAMEHPYLKQYHDPSDEPVSPPLDIDSDGDLTIDQWKELIWNEIGDFAEERAKRLAA
PTANNGAMS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaattgacgagaacactgaagcccgggttttatgcagtagaactgaataagacagtg
tggatcatcccgaactgttatcagaatctcacacctgttggtacgggtgcttatggaaca
gtgtgtgcagcagaatgtcgtccaacgggtgaaaaagtagccataaagaagttttcccga
ccattccaaagtgcaatccatgcaaaacgtacgcatcgtgaattgaagttgttacggtcg
atgaatcatgaaaatatcatcgatatgttagatgtattcactcctgacatcaacgctact
tcattacaagatgtatattttgtgtctatgttgatgggagcagatttatcaagcatatta
aaaattcagcgtctcagcgatgatcatattcagttccttgtttatcaaatacttcgtggt
ttaaagtatattcattctgccggtcttattcatcgcgacttgaagccatcaaatatagct
gtcaatgaagattgtgaattgaagatcctcgattttggtttagcgagacaaactgacagt
gaaatgacggggtatgttgccacgcgctggtatcgtgcccctgaaatcatgctcaactgg
atgcattacactcaaacagtggatatttggtcagttggatgcattatggcagaattaatt
accggtcgaactttgtttccaggagcggatcatattgatcaattaacgcgcataatgaat
gtagtcggtacgccaaacgaggaatttttatcaaaaatacaatcagatgaagctcgtaat
tacatacgtaatcttccaaaaactcccagaaaagatttcaaaagattgttcccaagcgca
tcacctgatgctattgatttgctggaaagaactctaaatctcgaccctgattatcgaccg
actgctagtgaggcaatggagcatccctacttaaagcagtatcacgatccatctgatgaa
cccgtgtcgccaccactcgatatcgattccgatggagatttaactattgaccaatggaag
gagttaatctggaacgaaattggagactttgcggaggaaagagcaaaacgacttgctgct
ccaactgcaaacaacggagcgatgagttga

DBGET integrated database retrieval system