KEGG   Brugia malayi (filaria): Bm1_32255Help
Entry
Bm1_32255         CDS       T01050                                 

Definition
RE35395p
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Bm1_32255
Transfer RNA biogenesis [BR:bmy03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Bm1_32255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 533 aa AA seqDB search
MTAGEISEEGTKAVNVIIAHLIKAHQEGKDVDLNRLKSKVSSVYALSRQPKLVDIIAAVP
TEHRNWLVPKLKAKPIRTASGIAVIAVMCKPHRNICVYCPGGPDSDFEYSTQSYTGYEPT
SMRAIRARYNPFLQTRSRVTQLMQLGHNVDKVEFIVMGGTFMSLPDDYRDYFIRNLHDAL
TGHTSSSVSEAVEFSERSRVKCIGITIETRPDYCLPKHLDEMLSYGCTRLEIGVQSVYED
VARDTNRGHTVKAVCECFEIAKNAGYKVVIHMMPNLPNVGIERDMEQFIELFENPEFRPD
GLKLYPTLVIRGTGLYELWRTGRYKSYPPEILVDLTARILALIPPWTRVYRVQRDIPMPL
VTSGVQYGNLREHALARMKQLGTACRDVRTREVGIQEIHNKIVPYQIELIRRDYVANGGW
ETFLSYEDPEQDILVGLLRLRKCADRVHRSELKGGVSIVRELHVYGSVVPVSARDPSKFQ
HQGFGQLLMEEAERIARNEHYSRKLAIISGVGTRNYYRKMGYELDGPYMLKSL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgggagagatttctgaagaggggacgaaagcagtgaatgtgatcattgctcac
ttaattaaagctcatcaagagggaaaagacgttgatttgaatcgtctgaagagtaaggtc
tcatcagtctatgcattaagtcgtcagccgaaattagttgatattattgcagcagtgcct
acggagcataggaattggttggtgccaaaactgaaagctaagccaattcgaacagccagt
ggtattgctgttattgctgttatgtgtaaacctcatcgtaatatctgtgtatactgtcct
ggtggaccagattccgacttcgaatacagtactcagtcctatacgggttatgagccaact
tcgatgcgagcaatacgtgctcgttataatccttttttgcagacaagaagccgagtaaca
cagcttatgcagcttgggcataatgttgataaagtagaattcatagtaatgggaggtact
ttcatgtcattaccggatgattatcgggactattttattcgaaatcttcatgacgcattg
actggtcatactagcagcagtgtgtctgaggcagtagaattcagtgaacgaagtcgagtg
aaatgtattggaataacgatcgaaacaaggcctgattattgtttaccgaaacatttagat
gaaatgttgagctacggttgtacaagattagaaattggtgttcagtcagtatacgaagat
gttgctagggatacgaatagagggcatactgtcaaagcagtatgcgaatgttttgaaata
gcaaaaaatgcgggttacaaggtggtaatacatatgatgccaaatctccctaatgttggg
attgaacgagacatggaacagtttatcgagctttttgaaaatccagaatttcgaccagat
ggtcttaaattatatccaacgttggtcattcgtggcactggcttatatgaactatggaga
actggacgttataaaagttatccaccagagattttggtggatttgacggctcgtattctc
gctttgatccctccatggactcgtgtttatcgtgtacaacgtgatataccaatgccgctt
gttactagtggagtacagtatggaaatcttcgcgaacatgctcttgcacgtatgaagcaa
cttggtactgcatgtcgagatgttaggacacgtgaagttggaattcaggaaatacataat
aaaatcgttccttaccaaattgaactgattcgtagagattatgtcgctaatggtggatgg
gagacatttctttcttacgaagatccagaacaggatattttagttggtctgctaagatta
cgaaaatgtgcagatagagttcatcgatctgagttaaagggtggagtatcaattgttcgt
gaactgcatgtctacggttcagtagtaccggtatcggctcgagatccatccaaatttcag
catcagggatttggccaattactaatggaagaagcagaacgaatcgccagaaacgaacat
tacagcagaaaattagcaattatttctggtgtaggtacaaggaattattatcggaaaatg
gggtacgaactggatggtccttacatgttgaaatcgttataa

DBGET integrated database retrieval system