KEGG   Brugia malayi (filaria): Bm1_32350Help
Entry
Bm1_32350         CDS       T01050                                 

Definition
(RefSeq) O-Glycosyl hydrolase family 30 protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00511  Other glycan degradation
bmy00600  Sphingolipid metabolism
bmy01100  Metabolic pathways
bmy04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bm1_32350
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bm1_32350
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Bm1_32350
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Bm1_32350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 6101359
NCBI-ProteinID: XP_001897915
AA seq 447 aa AA seqDB search
MTLIISECKRTGVIRLGTDSKIRFQTIIGFGGAFTDAAGINIDSLSVSARNHLLQSYFGK
TGIQYTIGRVPIASTDFSTHAYSYDDSPNDFALTNFSLAEEDFKFKIPYIKQAVSLTDGV
LKLFASPWSAPGWMKTSGQMIGGGTLRGPPNGSYHVTWANHYVKFLETYKKNGVTFWGLT
VQNEPVSGIDLSYKWQTMYFSPKAEGDFIKNHLGPALRRSEVGRNISLMIMDDQRTQLPI
WADVVLKDKEAAQYISGIAVHWYNDFVPVSQLSETHSRHPNKFIFGTEACTGFKPFEHSP
LLGDWSRGEMYAHDIIQDLSHWVSGWTDWNLCLNLNGGPSFVKNYVDAPIIINATADEFY
KQPMFYVMGHFSKFIPPGSVRIELHFYMKPVLYEGVAFVTPAHQQVLVLLNRGNKSVTFS
VEDKAKNGLALRIQLESKSIATVIWNK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacattgataatatcggagtgcaaaagaaccggagtcattcgcttgggaactgatagt
aagatacggttccaaacaataattggatttggtggagcattcactgatgcggccggtatt
aatatcgactcgttgagtgtgtcagctcgaaaccatctgttgcagtcctattttgggaag
acaggtatacaatatacgattggcagagtgccgattgcaagtactgatttctcaactcat
gcatattcatatgatgattcaccgaatgattttgctcttaccaatttctcactggctgaa
gaagatttcaagttcaaaattccttatatcaagcaagcagtaagcttaacagatggtgta
ctcaaattattcgcttctccatggtcagcaccaggatggatgaaaacaagtggacaaatg
attggtggcggaacgttacgtgggcctcctaatgggtcatatcatgtgacatgggctaac
cactatgtgaaatttcttgagacatacaagaagaatggcgtaacattttggggacttact
gttcaaaacgaaccggtatctggcattgatctgtcgtacaagtggcaaacaatgtatttt
agtcccaaagctgaaggcgattttataaaaaatcatcttggtccagcgttacgaagaagt
gaagtgggtcggaatatatcgttaatgataatggatgaccaacgaacacagctgccaatt
tgggctgatgtggtccttaaagataaggaagctgctcaatacatatctggcatagcagtg
cattggtataacgattttgtgccggtgtcacaactttctgaaacacacagtcgtcatcca
aataagtttatcttcgggactgaggcgtgtactggattcaaaccttttgaacatagtccg
cttctgggagattggtcacgcggagagatgtatgctcacgatatcattcaggatctttct
cactgggtgtctgggtggactgattggaatctctgtcttaatttaaacggtggaccgagc
tttgtcaaaaattatgtagatgcaccaataataataaatgcaactgctgatgagttttac
aagcaacctatgttttacgttatgggacatttcagtaaattcattccaccgggttcagtt
cgaattgaattgcatttttacatgaagccggttttgtatgaaggagttgcattcgttact
ccagcgcaccaacaagtattagtacttttgaatcgtggtaataaatcagtgacattttcg
gtcgaagataaagctaaaaatggcttggccctccgcatacagctagaatcaaaaagcatt
gcaactgttatttggaataaatag

DBGET integrated database retrieval system