KEGG   Brugia malayi (filaria): Bm1_32635Help
Entry
Bm1_32635         CDS       T01050                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bmy  Brugia malayi (filaria)
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Bm1_32635
Enzymes [BR:bmy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Bm1_32635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 188 aa AA seqDB search
MLRTELEIEHIEQIDGLKLIRPKLFPDTRGYFVESYNEYELGALGFSEKFKQDNHSYSKC
GVLRGLHAQPGMGKLVSVISGEIYDVAVDIRSMSKTFGKWYGVVLDEKTRTAFWIPDGFL
HGFYVLSEEGAHVTYKCTAIYNEQVEFGVNPFDPELAIDWHISNSYKLIISDRDRSHQNL
KCLSFKKE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaacagaattagagattgaacatatcgaacaaattgatggactaaaacttatt
cgaccgaaactttttccggatactcgcggttacttcgtagagtcatacaatgagtatgaa
ttaggtgctttagggttttccgagaaattcaagcaggataatcattcctactcaaaatgt
ggcgttttacgtggcttacatgcacagccaggaatgggtaaattagtatcggttataagt
ggtgaaatatatgatgttgctgttgatataagatcaatgtcgaaaacttttggaaaatgg
tacggtgttgttctcgatgaaaagacgcggacagctttttggataccagatggttttttg
cacggattttatgttttatcagaagaaggagcacatgtaacatataaatgtacagcgata
tacaatgagcaagtggaatttggtgtaaatccgtttgacccagaattagccattgattgg
cacattagtaattcttacaaattgattattagtgaccgagatcgatctcatcagaatttg
aagtgtttatcatttaagaaagaataa

DBGET integrated database retrieval system