KEGG   Brugia malayi (filaria): Bm1_32735Help
Entry
Bm1_32735         CDS       T01050                                 

Definition
putative neuropeptide receptor NPR1
Orthology
K04209  
neuropeptide Y receptor, invertebrate
Organism
bmy  Brugia malayi (filaria)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:bmy04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MYNNNNTCLDMNAELWRNRRDWSTQSFTIFIFVFFYAAIILIGIVGNLCVILAISRTRTL
QTVPNMFIFSLSCSDLVVCFTSATITPIAAFKKEWIFGAVLCSVAPFIAGASLCFSTFTL
SAISVDRFLLIYFPTRKALSRLQALIVIMVICMLSTSLSAPVIFKQRLKRFGNYCGHFCT
EEWGIDQSGRRVYGSIMLSVQFIVPLVIITFCYTAISFKLGKQRAAIKRRQRTNRMLIGM
VVAFSASWFFSVLFNVLRDYDCLPKWCQNQEYFFGIATHCIAMSSTVWNPLLYAALNLQL
RAAFFRLLPECVRQPEMQKSATYNCKPLLQSGSALRNDLTKNKILNCDHRKSCDLLAVYK
AVNRYESFEVDDI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtacaataacaataatacctgcctggatatgaacgcggaattatggcggaataggcgc
gattggagcactcagtcatttactatattcattttcgtctttttttatgcagcaattatc
ctcatcggtattgtaggcaatctatgtgtcatattggccatatctaggaccaggacactg
caaacagtacccaatatgttcattttctcattgagttgctccgaccttgttgtatgcttc
acctcagcaacaataacaccaatcgcagcattcaagaaggaatggatttttggtgctgtg
ttatgttccgtagcaccctttattgctggcgcttcattgtgcttctctacatttactctc
tcagcaatctcagtggatcgttttttgcttatctattttccaactagaaaagctttatcc
aggcttcaagcattaatcgtaattatggtaatatgcatgttatctacttcattatcagcg
ccggtaatattcaagcaaaggcttaaaagattcggcaattactgtggccatttctgtact
gaagaatggggtatcgaccaaagcggtagacgagtttatgggtcaataatgctgagcgta
caattcatcgtacctctggtgatcatcactttttgctacactgctatctctttcaaatta
ggcaagcagcgtgcagccataaaacgcagacaacgaacaaatcgtatgctaattggaatg
gtggttgcgttttctgcaagctggtttttcagcgtattatttaacgttctcagggattac
gactgtctgccgaagtggtgccaaaatcaggaatactttttcgggattgcaacacattgc
attgctatgtcctcaactgtatggaatccattgctttatgcagctctaaatttgcaatta
cgtgctgctttttttcgattactacctgaatgtgtaaggcaaccagaaatgcagaaaagt
gctacttataactgtaagcctctccttcaatccggaagtgctttgcggaatgatttaaca
aaaaataagatactgaattgtgatcacagaaaaagttgcgatctattagcagtctataaa
gcagtgaatcgatatgaaagttttgaagtagatgacatttaa

DBGET integrated database retrieval system