KEGG   Brugia malayi (filaria): Bm1_32915Help
Entry
Bm1_32915         CDS       T01050                                 

Definition
Eukaryotic translation initiation factor 4E type 3, putative
Orthology
K03259  
translation initiation factor 4E
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_32915
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Bm1_32915
Translation factors [BR:bmy03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Bm1_32915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 232 aa AA seqDB search
MLETLVEGEPKMSGGDNLLEAKGELKQQSKPDLVLLVKPSPCNDSEHPLEFTYVFSYFVR
PQGKFDPEDYALYVQPVASFNSVEQFWNTYCFLKRPADINEKVDFHMFKEGIKPVWEDDA
NRKGGKWILRLKKGFSSRIWENLILAMIGEQFLVGEEICGAVCSIRNQEDIVSLWNRTAD
NLATTNRIRDTLRRVLNLPPNAILEYKRHDDCLKHGPKQLSPYKCGFAEKIK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaacgcttgttgaaggagagcctaaaatgtctggtggtgacaatttgcttgaa
gcaaaaggagaattgaaacagcaatcaaaaccagatttagtgctattagtgaaacccagt
ccttgcaatgacagtgagcatcccctggaattcacctacgtgttttcgtattttgtacgt
ccacaagggaaatttgatccagaagattatgctttatatgtgcaaccagtggcttcgttt
aattccgtggagcagttctggaatacatattgtttcttgaaacgtccagctgatatcaat
gagaaagtagatttccatatgttcaaagagggtatcaaacctgtttgggaagatgacgca
aatcggaaaggtggtaaatggattctgcgtttgaaaaagggtttttcatcaagaatatgg
gaaaatttgatattagcaatgattggcgagcagttccttgtaggtgaggaaatttgtggt
gcagtatgctccattcgtaatcaagaagacattgtatctttatggaatcgcacagcagat
aatttggcaacaacaaaccgtattcgtgacactttgcgacgggttttaaatctacctcca
aatgcgattttggagtacaagcgtcatgatgattgcttaaagcatggaccaaagcagtta
tcgccatacaaatgtggatttgccgagaagataaaatga

DBGET integrated database retrieval system