KEGG   Brugia malayi (filaria): Bm1_33170Help
Entry
Bm1_33170         CDS       T01050                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Bm1_33170
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Bm1_33170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 778 aa AA seqDB search
MAPIDRFQIGSQCNNVSCMQRFMQLCEDFSSVKAGEAIHCRMFEDVQRSSEVVQESTPTA
CIEVECNDTKVRQDIECPHKNKKGLFKVSNLRKKVRNFKKKVGINYCEDCARLDPPEQRP
SMWICVTCSYSGCDEKNHTLNHFRASRTGTEHPLFFAVEGKQFRCFSCEKRIDVAEEEGG
SVKAFINDYNSFIKPKLKTDPSESQLMKSNNTKRNSSIIGKIDSKKKENSNEKCLTKSKM
KNNEKKTLLPVKGLGNLGNTCFFNSITQCLLHTHTLAVYIDLVGKEDNIELMQNKVLIGD
RQVQVPHVYLSLASFDGPLNNIFANFIRDFKAGLPVHPSSLFSEIARKAPRFRGWAQQDA
HELLRYLMDGLRTEEINRYKEAISRYIKLARNGNPKLTDSELSLLAKGMLKACGRPLIDA
VFGGTLLQTVKCSKCGHLSKTYEDFLDLSLPLPSTSAKTLFNGTYKMHKSASMSLSKHQI
KKEKANARKGKIRRKSHEVIPHNDEINHNGERLHLSNDISDEDVLDDDDADPKTVDGDIC
DEMNKINVSTEPEDCLQLLDGAEAVEDEPRSLASCLRAFTITEFLCGPNTYECEKCCVPY
NKQLRNGMKKRTVEAEKRYLIYEPPPVLTLHLKRFEQTHSVSGRVITRKVPGQISFPKIL
NIAPFCTQIAKRIEKGLKKVCYSLYGVVSHFGDLSSGHYVAFIKNRYPSSQTEKFFYESA
NLSPPDSVVTCSASELKEIIEGPCDGEWYYASDMSVSSVSESRVLSTEAYVLFYERIL
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaattgatcggtttcagattggctcgcaatgcaacaatgtttcgtgcatgcaa
cgcttcatgcaactttgcgaggacttctctagtgtcaaagcaggtgaagcaatacactgt
cgtatgtttgaggacgtacaacgttcctctgaagtggtacaggaatccactcctaccgct
tgtatagaagttgaatgtaatgatactaaagtgcgacaggatatagaatgcccacataag
aacaagaagggattatttaaagtttcaaatttgcggaaaaaagtgagaaattttaaaaag
aaagtgggaattaattattgcgaagactgcgcaaggctcgatccacccgaacaacgacca
tcgatgtggatatgcgtcacttgcagctattccggttgtgatgaaaaaaatcacacttta
aatcactttagagcatcgcgcactggcacggagcatccgcttttctttgctgtggaaggc
aaacaattccggtgcttcagctgtgaaaaaagaattgatgttgctgaagaagaaggtggt
tcagtaaaagcttttattaatgattataattctttcataaaaccaaaactgaagactgat
ccatcagaatctcagttaatgaaaagtaataacacgaaaagaaactcttcaataattgga
aaaattgattcgaaaaagaaagaaaatagtaacgaaaagtgtttaacaaaaagtaaaatg
aaaaacaatgagaagaaaacattgcttccagtaaagggcctcggtaatcttggaaacact
tgcttttttaattcgataactcagtgccttcttcatactcatactcttgctgtgtatatc
gatttggttggtaaagaagacaatatcgaactcatgcagaacaaagttttaattggtgac
aggcaagtgcaggtaccacatgtatatttgtctctggcttcatttgatggaccgttaaat
aatatttttgcgaatttcatacgcgatttcaaagctggactacctgtccatccttcttct
ttattcagtgaaatagccaggaaagcaccacgttttcgtggttgggcgcaacaggatgct
catgaattattacggtatttaatggacggtctccgaacggaagaaattaaccggtataaa
gaagctatttcacgatatatcaaactagctagaaatggaaatcctaagttgacggatagt
gaactctctttattggctaaaggcatgctcaaagcatgtggaaggccacttattgatgct
gtttttggtggcacacttttgcaaacagttaaatgttcgaaatgtggtcatctttctaaa
acttatgaagatttcttggatctttctcttccacttccgtcaacatcagccaaaacatta
tttaatggaacctataagatgcacaaatctgcttcaatgagtttaagtaaacatcagata
aaaaaggaaaaagcgaatgcacgcaaagggaaaatacgtcgaaaatcacatgaagtcatc
ccacataatgatgagattaatcataatggggaacgacttcatctcagtaatgatattagc
gatgaagacgttcttgatgacgatgatgctgatccaaaaactgttgacggtgatatatgt
gatgaaatgaataaaattaacgtgagtactgagccagaagattgcctgcaattgttggat
ggtgcagaagctgtagaggatgaaccacgttcattagcgtcgtgtcttcgagcttttaca
ataacagaatttttgtgtggaccaaatacttatgaatgtgaaaagtgctgtgttccatat
aacaaacagcttcgaaatggaatgaagaaaagaacagttgaagctgagaagcgttatttg
atttatgagccacctcctgttctaacattacatcttaaacggtttgaacagacacattca
gtgagtggtcgagtgatcacgcgcaaggttcctggacaaatttcttttccaaaaattctt
aatattgcacctttttgcacacaaatagccaagagaatcgaaaaaggattaaaaaaagtg
tgctattcattatacggtgttgtttcacattttggggatctctcatctggtcattatgtc
gcatttattaagaatcgatacccttcgtcgcaaacagaaaaatttttttatgaatctgcg
aatctttcgccaccggattcagtggttacttgtagtgcttcagaattaaaggaaataata
gagggaccatgcgatggcgaatggtactatgcaagtgatatgagtgtaagctccgtatcg
gaatcacgcgtacttagtaccgaagcttatgtccttttctacgaacgaatcctttag

DBGET integrated database retrieval system