KEGG   Brugia malayi (filaria): Bm1_33495Help
Entry
Bm1_33495         CDS       T01050                                 

Definition
(RefSeq) Probable protein disulfide isomerase A6 precursor, putative
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Bm1_33495
Enzymes [BR:bmy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bm1_33495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 445 aa AA seqDB search
MKSFLLTILVGLSHALYDGNRNVIQLTESNFNNKVLKSDEIWIVEFFAPWCGHCQKLVPE
YMKLANALKGIFKVGAVDMTQHQSVGAQYNIQGFPTIKIFGADKKTCGIKPFKNHRNKVI
KGPRTAQAITDSLINELRKTVNAKLGISSSSQSRGANDKKSSGKYVIELTDSNFEEMVLH
SKDIWLVEFFAPWCGHCKALKPHWEMAASELAGKVKVGALDATVHQAMASHFGIKGFPTI
KYFAPGSSASDAEDYVGGRTSDDIVQYALNKVAENMPEPEVVEAISQEVVDNACREKQLC
IIAVLPHILDCQSSCRKNYLEVLKESAKKFKRNVWGWVWTDAGKQTELEEAFGMGGFGYP
ALAALNYRKMKFSMLKGSFGVSGIQEFLRDLSYGKGQTAPVKNAEFPKIMNVEPWNGKDG
ELPLEEDIDVSDVDLDEEKPKKTEL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcatttctcttaacaattttggttggactgtcgcatgcactctatgatggtaat
cgtaatgtaatccaattaacagagtcgaatttcaacaataaagtgttgaaaagtgatgaa
atatggattgttgaattttttgcaccatggtgtggtcactgccagaaattagttccggaa
tatatgaagctggcaaatgccttgaaaggtattttcaaagttggagcggtggacatgaca
caacatcagtcagtgggtgcacaatataatatacagggctttcctacaattaaaatattt
ggtgctgataaaaagacctgtggaattaaaccgtttaaaaatcataggaataaagtcatt
aaaggtcctcggacggctcaggcgataacagattccctaataaatgagcttcgaaaaaca
gtaaatgcgaaactgggtattagcagttcaagccagtcgagaggtgctaatgataagaaa
agcagcggtaaatatgtcattgaattgaccgatagcaactttgaggagatggtgcttcat
agtaaagatatttggcttgtggaattctttgcaccttggtgcggtcattgtaaagcttta
aaaccacattgggaaatggctgcttcggaattagctggtaaagtgaaggttggtgctttg
gatgcaacagtacatcaggcaatggcatcacatttcggtatcaaaggtttcccaaccata
aaatatttcgcaccaggttcaagtgctagtgatgctgaagattacgtcggtggacgaacc
agtgatgatattgttcaatatgcacttaataaagttgctgaaaatatgccggaaccggaa
gttgtggaagcaatttcacaagaagttgtcgataacgcttgcagagaaaagcagctttgt
ataattgctgtactgccgcatattcttgattgccaaagcagctgccgaaaaaattattta
gaagtcttgaaagaatcggcaaaaaaattcaaacgaaatgtgtggggttgggtatggact
gatgcaggtaagcaaactgaattggaggaagcatttggcatgggcggtttcggttatccg
gctttggcagcgctgaactatcgtaaaatgaaattttcgatgttaaaaggttcctttggt
gtctctggaattcaagaatttttaagggatctttcttatggtaaaggtcaaacagcacca
gtgaaaaatgcagaattcccgaagatcatgaatgtagaaccatggaatggtaaggatggc
gagctgcctcttgaggaagatatcgatgtttcagatgttgatttggatgaagagaaaccg
aagaaaactgaactgtag

DBGET integrated database retrieval system