KEGG   Brugia malayi (filaria): Bm1_33495Help
Entry
Bm1_33495         CDS       T01050                                 

Definition
Probable protein disulfide isomerase A6 precursor, putative
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bmy04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 445 aa AA seqDB search
MKSFLLTILVGLSHALYDGNRNVIQLTESNFNNKVLKSDEIWIVEFFAPWCGHCQKLVPE
YMKLANALKGIFKVGAVDMTQHQSVGAQYNIQGFPTIKIFGADKKTCGIKPFKNHRNKVI
KGPRTAQAITDSLINELRKTVNAKLGISSSSQSRGANDKKSSGKYVIELTDSNFEEMVLH
SKDIWLVEFFAPWCGHCKALKPHWEMAASELAGKVKVGALDATVHQAMASHFGIKGFPTI
KYFAPGSSASDAEDYVGGRTSDDIVQYALNKVAENMPEPEVVEAISQEVVDNACREKQLC
IIAVLPHILDCQSSCRKNYLEVLKESAKKFKRNVWGWVWTDAGKQTELEEAFGMGGFGYP
ALAALNYRKMKFSMLKGSFGVSGIQEFLRDLSYGKGQTAPVKNAEFPKIMNVEPWNGKDG
ELPLEEDIDVSDVDLDEEKPKKTEL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcatttctcttaacaattttggttggactgtcgcatgcactctatgatggtaat
cgtaatgtaatccaattaacagagtcgaatttcaacaataaagtgttgaaaagtgatgaa
atatggattgttgaattttttgcaccatggtgtggtcactgccagaaattagttccggaa
tatatgaagctggcaaatgccttgaaaggtattttcaaagttggagcggtggacatgaca
caacatcagtcagtgggtgcacaatataatatacagggctttcctacaattaaaatattt
ggtgctgataaaaagacctgtggaattaaaccgtttaaaaatcataggaataaagtcatt
aaaggtcctcggacggctcaggcgataacagattccctaataaatgagcttcgaaaaaca
gtaaatgcgaaactgggtattagcagttcaagccagtcgagaggtgctaatgataagaaa
agcagcggtaaatatgtcattgaattgaccgatagcaactttgaggagatggtgcttcat
agtaaagatatttggcttgtggaattctttgcaccttggtgcggtcattgtaaagcttta
aaaccacattgggaaatggctgcttcggaattagctggtaaagtgaaggttggtgctttg
gatgcaacagtacatcaggcaatggcatcacatttcggtatcaaaggtttcccaaccata
aaatatttcgcaccaggttcaagtgctagtgatgctgaagattacgtcggtggacgaacc
agtgatgatattgttcaatatgcacttaataaagttgctgaaaatatgccggaaccggaa
gttgtggaagcaatttcacaagaagttgtcgataacgcttgcagagaaaagcagctttgt
ataattgctgtactgccgcatattcttgattgccaaagcagctgccgaaaaaattattta
gaagtcttgaaagaatcggcaaaaaaattcaaacgaaatgtgtggggttgggtatggact
gatgcaggtaagcaaactgaattggaggaagcatttggcatgggcggtttcggttatccg
gctttggcagcgctgaactatcgtaaaatgaaattttcgatgttaaaaggttcctttggt
gtctctggaattcaagaatttttaagggatctttcttatggtaaaggtcaaacagcacca
gtgaaaaatgcagaattcccgaagatcatgaatgtagaaccatggaatggtaaggatggc
gagctgcctcttgaggaagatatcgatgtttcagatgttgatttggatgaagagaaaccg
aagaaaactgaactgtag

DBGET integrated database retrieval system