KEGG   Brugia malayi (filaria): Bm1_34625Help
Entry
Bm1_34625         CDS       T01050                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor, putative
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmy  Brugia malayi (filaria)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_34625
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bm1_34625
  Amino acid metabolism
   00310 Lysine degradation
    Bm1_34625
Enzymes [BR:bmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bm1_34625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 350 aa AA seqDB search
MAFCDHDGLDERKGARNSLIFVVTFNAIANLAEFHSYNFSSSTSIFLLSTERQSMLRRAA
SAYSRVLVNQKKGEFVXRDDLVAEIETDKTTVEVPSPQSGTIVELLVEDGGRVTAHQKLY
KLEVGGEAPAKSTKEAKQPVEEKTPPPPKADSVQTSPSSSPEKPVTPSPMKIAAAPLPSY
SQPKPDSPIEKVPSLTDHSPFTGSRDETRVKMNRMRLRIAQRLKDAQNTYAMLTTFNEVD
MSNVLEMRKRYQKEFIAKYGIKIGLMSPFIRASAYALQEFPTVNAVIDEGEILYRHYIDV
SVAVATPKGLVVPVLRNVETMNYAAIEKTLNEYAIKKIKGEAHKDFVRFL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctgtgaccatgatggactggatgagaggaagggagcgagaaattctcttata
tttgttgtgacatttaatgcaatagcaaatttagccgaattccattcttacaatttttca
agttctacaagtatttttttgctgtcaacagaacgccaatccatgttgcgacgtgccgct
tctgcgtatagtcgtgtgctggtgaatcagaaaaagggtgaatttgtcartcgagatgat
ttggttgctgagattgaaactgataagacaaccgtagaagtaccatccccacagtcagga
acaatagtcgaacttttagtagaagatggcggtcgagtaacagcacatcagaaactgtat
aaactagaagttggaggagaagcacctgctaagagtacaaaagaagcgaagcaaccagta
gaggaaaaaactccgccaccaccaaaggctgattcggtgcagacatcaccttcatctagt
ccagaaaagccagtcactccatctccaatgaaaattgcagctgcacctcttccatcgtat
tcccaacctaagccagattctcctatagagaaagtaccatcactcactgatcatagtcct
tttactggttcaagagatgagacacgcgtgaaaatgaaccgaatgcgtttaagaatagca
cagcggttgaaagacgctcagaacacttacgctatgcttactactttcaatgaagtggac
atgagcaatgtactggaaatgaggaaacgctatcaaaaagaattcatcgcaaaatatggc
attaaaattggattgatgtcgccatttattcgagcatcggcttatgcgttacaagaattt
cccaccgttaatgctgtaatcgatgaaggcgagatattgtatcggcattatattgacgtg
tcagttgcagtcgctacaccgaaaggtctggtagtgcccgtactgcgtaatgttgaaaca
atgaattatgcagccatcgaaaagacactgaatgaatatgcaattaaaaaaataaaggga
gaagcgcacaaggatttcgtaagatttctatag

DBGET integrated database retrieval system