KEGG   Brugia malayi (filaria): Bm1_34625Help
Entry
Bm1_34625         CDS       T01050                                 

Definition
(RefSeq) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor, putative
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmy  Brugia malayi (filaria)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_34625
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bm1_34625
  Amino acid metabolism
   00310 Lysine degradation
    Bm1_34625
Enzymes [BR:bmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bm1_34625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 350 aa AA seqDB search
MAFCDHDGLDERKGARNSLIFVVTFNAIANLAEFHSYNFSSSTSIFLLSTERQSMLRRAA
SAYSRVLVNQKKGEFVXRDDLVAEIETDKTTVEVPSPQSGTIVELLVEDGGRVTAHQKLY
KLEVGGEAPAKSTKEAKQPVEEKTPPPPKADSVQTSPSSSPEKPVTPSPMKIAAAPLPSY
SQPKPDSPIEKVPSLTDHSPFTGSRDETRVKMNRMRLRIAQRLKDAQNTYAMLTTFNEVD
MSNVLEMRKRYQKEFIAKYGIKIGLMSPFIRASAYALQEFPTVNAVIDEGEILYRHYIDV
SVAVATPKGLVVPVLRNVETMNYAAIEKTLNEYAIKKIKGEAHKDFVRFL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctgtgaccatgatggactggatgagaggaagggagcgagaaattctcttata
tttgttgtgacatttaatgcaatagcaaatttagccgaattccattcttacaatttttca
agttctacaagtatttttttgctgtcaacagaacgccaatccatgttgcgacgtgccgct
tctgcgtatagtcgtgtgctggtgaatcagaaaaagggtgaatttgtcartcgagatgat
ttggttgctgagattgaaactgataagacaaccgtagaagtaccatccccacagtcagga
acaatagtcgaacttttagtagaagatggcggtcgagtaacagcacatcagaaactgtat
aaactagaagttggaggagaagcacctgctaagagtacaaaagaagcgaagcaaccagta
gaggaaaaaactccgccaccaccaaaggctgattcggtgcagacatcaccttcatctagt
ccagaaaagccagtcactccatctccaatgaaaattgcagctgcacctcttccatcgtat
tcccaacctaagccagattctcctatagagaaagtaccatcactcactgatcatagtcct
tttactggttcaagagatgagacacgcgtgaaaatgaaccgaatgcgtttaagaatagca
cagcggttgaaagacgctcagaacacttacgctatgcttactactttcaatgaagtggac
atgagcaatgtactggaaatgaggaaacgctatcaaaaagaattcatcgcaaaatatggc
attaaaattggattgatgtcgccatttattcgagcatcggcttatgcgttacaagaattt
cccaccgttaatgctgtaatcgatgaaggcgagatattgtatcggcattatattgacgtg
tcagttgcagtcgctacaccgaaaggtctggtagtgcccgtactgcgtaatgttgaaaca
atgaattatgcagccatcgaaaagacactgaatgaatatgcaattaaaaaaataaaggga
gaagcgcacaaggatttcgtaagatttctatag

DBGET integrated database retrieval system