KEGG   Brugia malayi (filaria): Bm1_35010Help
Entry
Bm1_35010         CDS       T01050                                 

Definition
MHCK/EF2 kinase domain family protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     Bm1_35010
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   Bm1_35010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 741 aa AA seqDB search
MDSTENHGKYVGSTSPTQGDDAENEHLDDSEEWQLLEPLCDISESVKRKFSQLDPLDNRN
YQQFEPDPRSSRLSEGNRGLMHRWQQVAAWCVKHPDDPWVKFHFDQLPVRDCKRHRYSCI
QQCWTVDDVQVKLHPEPFARGAMRECYRLKKLGSRGKNDDWDHAQNYVAKKYIRSVDKEV
LFEDVKLQMDSKLWAEEFNRHHPPKKIDIFQVCILEFLDESEHAFYHLERFIEGEYIKYN
SNSGFVSDICRQTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTATGEGYGNGNLG
TKGMALFFHSHLCNDICRSMCLTEFDLAASERNALKGGDNVERNWTSMTRSSSNRPASIC
SSLVEENGNAMEELRRRTVSVNSSGRRSSASSFCDEHSTDTQHSDVRFYSDYFEQIVHDS
DKPMAKTRFTSSCSSNLFDLTDSEVKERMHHDSQFESLSSCSSRMTRHITQEAEREAYWL
EKRKFSRPAGLLSESQIKQLSEFSQKLHGMNCILGQIHLDLARYHELGQFVDKSPFVCSE
KENXYSAKEQRNKRNAGNYISYDKDAAFYHLDIARRCGVLEAIITMAKMAFGHPHELLKE
VVCEEVWENDDLEGTGFELMECAADMGDQSAVIFVAQAYETGRFLGPMKKPSWPKAIAWY
EKALNFLQNSETNENETPHEGVRPRYELLERMAVMYKEGGYGLLQDLTKAYDLYTEAAMS
ATEAMQGKLANKYYELAEQCV
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggattcgactgaaaatcacgggaaatatgtaggctcaacttcaccaacacagggcgat
gatgctgaaaatgagcatttggacgactcagaagaatggcaattgctcgaacctctttgt
gacatttctgaatcggtaaaacggaagtttagccagttagatcccttagataatagaaat
tatcagcaattcgagcctgatcctcgttcgtcgcgcttatccgaaggaaatcgagggctg
atgcatcgatggcagcaggttgcggcatggtgtgtgaagcatccagatgatccgtgggta
aaattccattttgaccaattacctgtgagggattgtaaacgtcatcgttattcatgtata
caacagtgctggaccgttgatgatgtgcaagtgaaattgcacccggagcctttcgctcga
ggcgcaatgcgcgagtgttatcgcttgaaaaagctaggatcgcgtggtaaaaatgacgac
tgggaccatgcacagaactatgttgctaaaaaatatataagaagtgttgataaagaagtt
ttgtttgaagacgtgaagctacaaatggatagcaaactttgggctgaggaatttaatcgt
catcatccacccaaaaagattgacatttttcaagtatgcattttggaatttcttgatgaa
agtgaacatgcattttatcatcttgaacgtttcatagaaggcgagtatattaagtacaac
tccaactctggctttgtatcagatatttgtcgacagacgcctcaggcattcagtcacttt
acatttgaacgtagtggacatcaattgattgttgtcgatattcaaggagtgggagatttg
tataccgatccgcaaatacataccgcaactggagaaggttatggtaatggaaatcttggt
acgaagggaatggcattgtttttccattcccatttgtgcaatgacatctgccgatcaatg
tgcttgacagagttcgatcttgctgcaagcgaaagaaatgcccttaagggaggtgataat
gtggagaggaattggacttcaatgactagaagtagcagtaacagaccagcaagtatttgt
tcgtctcttgttgaagaaaatggtaatgctatggaagagctgcggcgcagaacagtgtca
gtaaacagctcgggaagacgttcttcagcatcttcgttttgtgatgagcatagcactgat
acgcagcattctgatgtacgattttatagcgattactttgaacaaattgtgcatgactct
gataagcctatggctaaaacacgattcaccagttcatgttcctcaaatttattcgattta
actgatagcgaggtgaaagaacgaatgcaccacgattctcagttcgaaagtttgagtagc
tgcagttcgagaatgactcgacatattacccaggaagcagaaagagaagcttattggttg
gaaaaacgcaaattttcacgaccggcagggctgttatcagaatcgcaaatcaaacaactt
tctgaattttcgcaaaaacttcatggtatgaattgcatccttggccagatacatttggat
cttgcgcgttatcatgaattgggacagttcgttgataaatcgccttttgtttgttccgag
aaagaaaatrtttattcagcaaaagaacagagaaacaaaagaaatgcaggaaattatatt
agttacgacaaggatgcagcattttatcatcttgacattgctcgacgctgtggtgttctt
gaagcgataattaccatggctaaaatggcttttggtcaccctcacgagctgctgaaagag
gtagtttgcgaagaagtatgggaaaatgacgatctggaagggactggttttgagctgatg
gaatgtgctgcagatatgggtgatcagtccgccgtcattttcgtagcacaagcgtatgaa
acgggtcgttttctagggccaatgaaaaaaccctcatggccaaaagctattgcatggtat
gagaaagctttgaattttcttcaaaattcagaaacaaatgaaaacgaaacgcctcatgaa
ggagtccgtcctcgttatgagttgttggagagaatggcagtaatgtataaagaaggtgga
tatggtctattacaggatttaacgaaagcgtatgatttgtatactgaagcagctatgtca
gcaacagaagctatgcaagggaagttggccaataaatattatgaattggcagaacaatgt
gtgtaa

DBGET integrated database retrieval system