KEGG   Brugia malayi (filaria): Bm1_35765Help
Entry
Bm1_35765         CDS       T01050                                 

Definition
TPR Domain containing protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
bmy  Brugia malayi (filaria)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Bm1_35765
Protein phosphatases and associated proteins [BR:bmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Bm1_35765
Ubiquitin system [BR:bmy04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Bm1_35765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 764 aa AA seqDB search
MRGVTPSDNVDPTRSKEIENIIHCSLQHFEYDDAVMLAEVYHETVNTSDSLYLYAYCLTR
AERLEAAYNLLKLKFLSSPEIRYLFAHCCYHLEKETGRPDEAADEGKLALKQNVFSWTSL
KTLCNLGVGNPENIYTSLLTCVNEARSSDKPKTSKSMGVATRSAEKLTKNTEKRTPSGSK
EVEQKVTCFAPKKSKTGIAAKRNTELGIVRRRLEEGMETRRSARSYGVSQDSENQTVAKD
VRTCTRSRVAVLSASGTPRSLQDKQLRSMNRINEMELSKTPPPIPSIHKLIESNDDLPDT
APKLKDESAHQAQKSSLSRTRSGSQPCVIPLSSHDQNTVQFKQEPESLGVSIVFSRSSSS
VSLTSSCSPQPPRHRSREKFQLETCTRIMKRLQNFVSKPPSIERLQNSIADWGTLFTTVV
EHISWLAMLQCAVATYRSNSVIGRYNLMPEKCKKFALARELLARAYLEKLDYTRATEILE
ELRREFPHRVAGMEILSTALWHAQDVRRLSVLAMQITEECRFCPEGWCVAGNCFSVQKQH
DTAIECFERAVTINTRFPYAYTLLGHELLDSDHQSKAAAAFRQDFLISSTFSKPTRKRAL
LLCPTDYRAWFGLGLLHFKKEQVNLARVHLSRAVAINPFNSVLLCQLSVVEQALHNNDTA
MELLQNALKISPDNAACRFYRARLLYEMHDYARCLEELNDLKLIAHDEAQVFFLLGRVHK
KLGDTHLALLNFSLAAEMDPRGEQSRNNFTDAPYDDEPSSPPSE
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggagttacaccttctgataatgtagatcctacacgcagtaaagaaattgagaat
attatacattgctctcttcaacattttgaatacgatgatgcggtgatgttagctgaggtg
tatcatgaaacagtgaataccagtgattcgttgtatttatacgcttactgtttaacccga
gccgaacgtttggaggcagcatataatttattgaaactcaaatttctttcatctccggaa
attcgttatctgtttgcacattgctgttatcacctggaaaaagagactggtcgaccagat
gaagcggctgatgagggtaagttggcactaaagcaaaatgtattttcgtggacgagtttg
aaaacattatgtaatttgggcgtcggtaatccagaaaacatttacacaagtttgttgaca
tgtgtaaatgaagcacgttcatcagacaaaccaaaaacctctaaaagcatgggcgtagca
acgaggagtgctgagaaactgacaaaaaataccgagaaaagaacgccaagtggtagtaaa
gaagttgagcaaaaagtgacttgttttgcaccaaaaaaaagtaaaacgggcatagcagct
aaaagaaatacggaactaggtatagtcagaagacggctcgaggaaggcatggaaacacga
cgcagtgcccgctcatatggagtctcacaggatagtgaaaatcaaactgttgcaaaggat
gtgaggacatgtacacgttctcgtgttgcagttctttctgcaagtggaacaccacgtagt
ttgcaagacaaacagttgcgctcaatgaatcgtatcaacgaaatggagttgtcgaaaacg
cctccaccaataccttcaattcataaattaatagaatcaaatgatgaccttccagataca
gcgcctaaattaaaagatgaatctgctcatcaagcacagaaaagctcattaagtcgtaca
cgttcaggctctcagccttgtgttattcctctttcttcacatgatcaaaatactgtacag
tttaaacaggagccggaatcgttgggtgtctcgattgttttctcgcgttcatcatccagt
gtatcattaacatcttcttgttcaccccaaccacccagacatcgtagcagagaaaagttt
caattggagacatgtacgcgtataatgaaacgtttacaaaatttcgtttcaaaaccacca
tcaattgaacgycttcaaaactctattgctgactggggtactctgttcacaacagtggta
gaacacattagttggttagctatgcttcaatgtgctgtggcgacatacagatcaaactca
gtaattggtcgctataacctgatgcctgaaaagtgtaagaaatttgctttggcaagagag
ttgttggctcgagcgtatttggaaaagcttgattatacaagggcaacagaaatcctggaa
gaacttcgtcgagaatttccacaccgcgttgcaggaatggagattctttcaactgcattg
tggcatgcgcaagatgttcgtcgactgtcagtacttgccatgcagataacagaggaatgt
cggttttgtccggagggttggtgtgtagctggtaattgcttcagcgtacaaaagcaacat
gatacagccattgaatgcttcgaacgtgctgtcactatcaatacacgttttccttatgct
tatacgttgttaggacatgaattgctggattcggatcatcagagtaaagctgcagcagca
tttaggcaagattttctaatttccagtactttttcaaaaccaacacgaaagcgcgcactt
ttgctttgcccaacggattaccgtgcttggttcgggctgggtttattgcattttaagaaa
gaacaagtgaaccttgctcgcgttcacttaagtcgagctgtagcaatcaatccgtttaat
tccgtactactgtgtcaattatcagttgttgaacaagcactacataataacgatacggca
atggaactattacagaatgcgttaaagatttcaccagacaacgctgcttgtagattctat
cgtgctcgtttgctgtatgaaatgcatgattatgcgcggtgtctggaagaattaaatgat
ctaaaacttattgctcacgatgaagcacaggtatttttcctcttgggtcgcgtgcataag
aagcttggtgacacacatttagcgttattaaactttagtttggcggcagaaatggatcct
cgtggagagcagagtcgcaataactttaccgatgctccttatgatgacgaaccttcctct
cctccatctgaatga

DBGET integrated database retrieval system