KEGG   Brugia malayi (filaria): Bm1_35965Help
Entry
Bm1_35965         CDS       T01050                                 

Definition
SET domain containing protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
bmy  Brugia malayi (filaria)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Bm1_35965
Enzymes [BR:bmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Bm1_35965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1449 aa AA seqDB search
MSIKLMKQRWLVKEVDDKKDSTEIVDMDVDEKDEYEIISEMEKPSNFLTQRDVENEEPEA
IGISMHTQGNVASLEVKRPSRWDVGAPFCIQLNDALAPNTSDTIMDKCTTSLDEAFNGYN
KTTGENERKEMLTNETTAXKTSSTIMEKYTESNEISIATEHGYHQDSSLVDLSLDKIALP
CDPCDIALPPEPSELYGNISCALLPRITDDKLASEATLDKGKVIIKWKFTKTPKELSTGH
VXIWEPEVETRELPKLCPEEESRSQRCXEASLNSRTVAERLDSYGGESLLHTKSLLQXSA
DVEGAALSPCSSKPKSNVQLQDNTTLSSEQDQSNYAXHEMXILENQCVQMTALQKASEEQ
STSNKDLGSIYDNVSEIVLSSSKLHYDHNLNTDSRTLCGNETERTAETSVQKPVTSWFAK
HFPQEPHLKETKLPSESLSFLQQQWIMNVSKIETSGEGEKESSISSVSSATSVSMYSFDS
TPKTLPSSDLGILRTTEGRKQISETAGTVNVPADSTGSSNNESLLPEPALDLNEDEGELD
PSTLEISPMMLKSAGEPVQYEYLDENIILCDESLIKEAKVVRCFCEPTSVEIAEGRGCSS
GCINRELYTECGSRCPSGAGCANRRFHNKQYAKVEVFNAGIKGWGLRAAEPLEPGRFIIE
YVGEVIDAEEMIRRGRRYGKDPKHVHHYLMALKNGAVIDATAKGNVSRFINHSCDPNCES
QKWTVNRQLRVGFFVIKPIALGEEIVFDYQLERYGRKAQRCFCGAANCRGRIGDDSESEE
EDKISDEAEVEGSGTDDEVLLTKRKLKSEKKEKSLRTAKKRKRQPSAQRCNKAIVNALSR
GPPRNRTQVRDLVRLMVQVEQAPQRSSLIQCVRFAHPDVLRLFIQESGLRLLYVFLATDY
PIDDEQSVLQLQIKSLDLLNVMPIVNKNQVIDSHLASTVEKITSKRGPVDEIVEDIVRKL
EDAVCCDIPSTSKHSLLKDPDPIIERLHYEMVTKAAKLMEKWRNLREEYRIPRRERTDPV
PTQHDISRYVRKTDEDERNKRVIVDKKDDGSTLWRLSGFGPPSKKRCFDRRRLPKTDLPI
FVKDLTHLENEDFKQSPITVTDSLRINEDDEGENKPKKRRSRFDIVGERNPSSMYELYAA
DCDFYAPPPPKLLPEALFAAGLPDSVNFTYNEHSFPEFFDWNTVYAKYDPSSAAYQQFIN
YYQQQQYPMMGLLPCPLTPQNTTEITNILEAPSPPPPKRPKTPEERPNMLIIGPIDAENP
TDEDIEMLEKHLVTLKAKRAEIRKRLQEAQRKIAQESNEMSDVPPPPPPSQTKQSLWIQA
TTEEGAVYYYNKETRESVWTLPDESEGGNASADTTTIDTRATFKAEIVKYVGGMLEPIRK
LKFASADDYKYVLRKLTHTILEKELKRVGETELKVTESVRDKARKFVAEYLARLGDGQYS
RKNKVHNSY
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaaattaatgaaacaacgttggctagtgaaagaagtggatgacaaaaaagat
tcaactgaaatagtcgatatggatgtcgatgaaaaggacgagtatgaaattatttctgag
atggaaaaaccctcaaattttctcacgcaaagagatgtggagaatgaagagccggaggcg
attggaatcagtatgcatactcagggaaatgtcgcgagtttagaggtgaagaggccttcg
agatgggatgtcggagcaccattctgtattcagttaaatgatgctttggcgccaaataca
agtgacaccattatggacaaatgtactactagtttggatgaggcgttcaatggatataat
aaaaccactggtgaaaatgaaagaaaagagatgttaacaaatgagackactgcattmaaa
acttccagtacgataatggagaartatactgagagtaatgagatatccattgcaacggaa
catggatatcaccaagatagtagccttgttgatttgtcgctggacaaaatagcgcttcca
tgtgatccttgtgatatagctttgccgcctgaaccatctgaactttatggtaatattagt
tgtgcacttctacctcgcattacggatgataagcttgcttccgaagcaacattggacaag
gggaaagtaataattaaatggaagttcacaaaaacaccaaaagaactttctactggrcat
gtgaraatttgggaaccggaggttgaaacacgtgaattaccgaaattatgtcctgaagaa
gagtcaagatcacagagatgtrtagaagcttcattgaattcaagaactgttgctgaacgt
ttagattcttatggaggcgaaagtttgttrcacaccaaatctttacttcaayattccgca
gatgttgaaggagcagctctttcaccgtgctcatcaaagccgaagtcaaatgttcaatta
caagataacactactttgtcatctgaacaggaccaatcaaattatgcaawgcatgaaatg
raaattttggaaaatcaatgtgtacagatgacggcactgcaraaagcaagtgaagagcaa
tcaacgtcaaataaagatttaggatcgatctacgataatgtttcagaaattgtattgtcc
tcttcaaagcttcattacgatcacaatttgaacacggattcgagaactctgtgtggtaat
gaaactgagagaactgcagaaaccagcgtacaaaaaccagtcacatcgtggtttgcgaag
cattttccgcaggaacctcacttaaaagaaacgaaattaccatcagaatcgttatctttt
cttcaacagcaatggataatgaatgtttctaaaattgaaacaagtggagaaggtgaaaaa
gaatcttcaatatcctctgtttcatcagcaacatcagtttccatgtattccttcgattct
acccccaaaacacttccttcatcagatcttggcattttacgaactactgaaggacggaaa
cagatatcagaaaccgctggtactgtaaatgtacctgctgattcaactggttcgtcaaat
aatgaatctttgttaccggaacctgcgttagatcttaatgaggatgaaggagaacttgat
ccatcaacgctagaaatttcccctatgatgttaaagtcagccggtgaacctgtgcagtat
gaatatttggatgaaaatattatattgtgtgatgaaagtttaattaaagaggcgaaggtt
gtgcgttgtttttgtgaaccgacgtcggttgaaatagcagaaggtcgtggttgcagttcc
ggttgcattaatcgagagctctataccgaatgtgggtcacgatgtccaagtggggcggga
tgcgccaataggcggtttcataataaacaatatgcgaaagtggaagtattcaatgcaggt
ataaaaggttggggattgagagctgcagaaccacttgagcctggacgttttatcattgaa
tatgttggtgaggttattgatgctgaggaaatgatacgtcgtggaagaaggtatggtaaa
gacccaaaacatgtrcatcactatcttatggcgctaaagaayggtgctgtgatagatgca
actgcgaaagggaatgtttcacgattcataaatcattcttgtgatcccaattgtgaaagt
cagaagtggacagttaaccgtcagttgagagttggtttcttcgtgatcaagccaattgcg
ttgggagaggaaatcgttttcgactatcaacttgagcgttacgggcgaaaagcacaacga
tgcttctgtggtgctgcaaattgtcgaggccgaataggtgatgatagtgaaagcgaagaa
gaagacaaaatcagtgatgaagccgaagttgagggaagtggaacggatgatgaagtttta
ttgacgaagcgcaaattaaaatcagaaaaaaaggaaaaaagtttgcgcactgcgaaaaag
cgaaagagacaaccatcagctcagcgttgcaataaggcaatagtgaatgctttgtcacga
ggaccccctcgaaatcgcactcaagttcgtgatctcgttagattaatggtacaagtagaa
caagcaccacagcgttcctccctaatacagtgtgtccgatttgcacatcctgatgtacta
cggctattcattcaagaaagtggtctgaggcttttatacgttttcttagctaccgattac
ccgattgatgatgagcagtctgttcttcagttgcaaatcaaatcacttgatctgttgaac
gttatgcctattgtgaataagaatcaagtgatagatagtcatctagcttcaactgtggaa
aaaattactagtaaaagaggtccagtagatgaaattgtggaagatatcgtaaggaaatta
gaagatgcggtgtgttgtgatataccttcaacttcaaaacattcgcttttaaaagatcca
gatcctataatagaacgtttacactacgaaatggttacaaaagctgcgaaactgatggaa
aagtggagaaatttgcgtgaggaatatcgaatcccacgtcgggaacgcactgatcctgtt
ccaactcaacatgatattagtcgttatgtacggaagactgatgaggatgaaaggaacaaa
cgagttatagtagataagaaggatgatggcagtacactgtggagattaagtggatttgga
ccaccctccaaaaagcgctgcttcgaccgacgtcgcctccccaaaaccgatttgccaatt
ttcgtcaaagatttgacgcatctcgaaaatgaagatttcaagcaatcaccgataactgta
actgattcactacgcattaatgaagatgatgaaggagaaaacaaaccaaagaaacgtcgt
tcgcggtttgatatcgttggtgaaagaaatccgagttcaatgtatgaattgtatgctgca
gattgtgatttctacgctcctccaccaccaaagcttcttccggaagcattatttgctgcc
ggtttaccagattcagtaaatttcacatacaatgagcattcgtttccggaatttttcgat
tggaacaccgtatatgcaaaatatgatccatcatccgctgcctaccaacagtttattaac
tattatcagcagcaacagtatcctatgatgggattactaccatgtccactaactccgcag
aataccacagaaataacaaatatcttagaagcaccttctccgccaccgcctaaacgaccc
aaaactccagaagaaaggccaaatatgcttataattggtccaatcgatgcagaaaatccg
acagacgaagatattgaaatgctcgagaaacatttggtaacgctcaaggcaaaacgagca
gaaatcagaaaacgtttgcaagaggcacaaaggaagattgcacaagaatcaaatgaaatg
agtgatgtgccgccgcctcctccaccttcacaaactaagcagtcgttgtggatacargct
acaacagaggaaggagctgtttattattacaataaagaaaccagggaatccgtttggact
ttgcccgatgaatctgaaggtggaaatgcctcagctgacactacgactattgatacgcgt
gcaacattcaaagctgagatagtgaagtatgttggtggcatgttggaaccaattcgaaag
ctgaagtttgcatctgctgatgattataaatatgttttacggaaactgacacacacgata
ttggagaaagaattgaaacgggtcggtgagacggagcttaaagtcacagaatcagtgcga
gataaggcgcggaagtttgtagctgaatatttggcgaggcttggagatggccagtactcg
cgaaaaaataaagttcacaattcctactga

DBGET integrated database retrieval system