KEGG   Brugia malayi (filaria): Bm1_36125Help
Entry
Bm1_36125         CDS       T01050                                 

Definition
Hypothetical 41.4 kDa Trp-Asp repeats containing protein F10G8.3 inchromosome I
Orthology
K14298  
mRNA export factor
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_36125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 371 aa AA seqDB search
MFGTTNAFGSRPNSIFSSGTANTSQNPLNDIEVPSPPDDTVEALKFNPQIAGQPVLLVSG
SWDSVIRVWQISESGQCEAKAQQNVTGPVLDLDWLDDGTKIFIASADKQVRVWDLASNQM
VVVGTHDEPVRKCHWIKAPNYSCLMTGSWDKTLRFWDMRQLPTQTSLATVQLGERVYCSD
VLFPMSIVGLANRRMKIYRLDNEPSEVKDIETPLKYQSRCASIFKDKTTGLPTGYALGSI
EGRVAIQYVEAANPKDNFTFKCHRSPELINGFQEIYAVNDIAFHPSYGTLATVGSDGRIS
FWDKDARTKLKTSDPLPAPVTRCVIHASGQMMAYAIGYDWSKGHEGYNPQTVGSKIFLHA
CDEDMKPKQKK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtactactaatgcgtttggctcacgaccgaacagcatattttcatccggcaca
gccaatacaagtcagaatccactgaacgatattgaagtaccatcaccacccgatgacaca
gttgaagcgctgaaattcaatccgcagattgctggccagccagttttgcttgtttcgggt
agttgggattcagtgattcgtgtatggcagatcagtgaaagcggtcagtgtgaagcaaaa
gctcaacaaaatgttacaggaccagttttagatcttgactggcttgatgatggcaccaaa
atctttattgcaagtgcagataagcaagtacgagtttgggatctcgcttcaaatcagatg
gtcgtcgtgggaacacacgatgaacctgtcaggaagtgtcactggatcaaagctcccaat
tacagctgtttaatgaccgggtcatgggataaaactttacggttttgggacatgaggcag
ttgcctacgcaaacatctttagcaacagttcagcttggagaacgtgtttattgtagtgat
gtgttatttcccatgagtattgttggtctcgctaatcggcgtatgaagatttacagattg
gacaacgaaccatccgaagtgaaagatatcgagactccgttgaagtatcagagccgctgt
gcttcaattttcaaagacaaaacaactggacttcccactggatatgctcttggatctatt
gaaggtcgagttgcaatacaatacgttgaagctgctaacccaaaagataatttcacattt
aaatgccatcgctctccagaattgatcaatggattccaggaaatctatgccgtgaatgat
atcgcatttcatccgagttatgggacactggcaactgttggttctgatggtcggatttca
ttttgggataaagatgcaagaacaaaattgaaaacatcagatccactaccagcacctgta
acgcggtgtgttatacatgcttcaggacagatgatggcctatgctatcggttacgattgg
agtaagggccatgagggatataatcctcaaactgtcggaagtaaaatctttttgcatgca
tgtgatgaagacatgaaacctaaacagaagaagtaa

DBGET integrated database retrieval system