KEGG   Brugia malayi (filaria): Bm1_36280Help
Entry
Bm1_36280         CDS       T01050                                 

Definition
Caveolin-1
Orthology
K06278  
caveolin 1
Organism
bmy  Brugia malayi (filaria)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Bm1_36280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 255 aa AA seqDB search
MALWADNSVPIAVCLVVLGFVNCCYPLLINYCSNSTLYSSLNQQYKISKKRMSDRRQEIQ
PEQVLLKSDTDPEKLKVETNSAKKENDVDKKERKKICRIWQRKSPRSYNFEREKDETKKL
RMSIGLDLENRDDKGLNNHIIMNFGEVFAEPDGSHSFNWTWLVTNRVFTATSVSIYKLLA
AFIAIPFAVFFGILFAVFAVISVFLCTPLGVLLTIPLNAFSKCWDFVICRFLNPITKAVC
CERKKDEKNAIVLDA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccttatgggcagacaattccgtcccaatagcagtctgcttggtagtgctaggtttt
gtgaactgctgttacccgttgctaatcaattactgctccaacagcacactttattcatcc
cttaaccagcaatataaaattagtaagaaaaggatgtctgatcgaagacaggaaattcaa
cctgaacaggtgctactgaaatcggacactgatccggagaagctgaaggtagaaactaat
tcagcaaagaaagagaatgatgttgataagaaggaacgtaaaaagatatgtagaatttgg
caacgaaaaagtcctcgatcatataattttgaaagagagaaggatgaaacaaaaaagttg
agaatgtcaattggattggatctcgagaatcgtgatgataaaggtctcaataatcatatt
atcatgaattttggtgaagtattcgcggaaccggatggaagccattcattcaattggact
tggcttgtaaccaatcgggtcttcacggctacaagtgtttcaatctacaaattactggct
gcttttattgcaataccattcgcagtatttttcggtattctgtttgcggttttcgcagta
attagcgttttcttatgtacaccacttggagtattacttacgataccactgaatgctttt
tctaagtgctgggacttcgtcatatgcagatttctgaacccaattaccaaagcagtctgc
tgtgaaagaaaaaaagatgaaaaaaatgcaattgtactggatgcttaa

DBGET integrated database retrieval system