KEGG   Brugia malayi (filaria): Bm1_36970Help
Entry
Bm1_36970         CDS       T01050                                 

Definition
Protein kinase domain containing protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Bm1_36970
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Bm1_36970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 817 aa AA seqDB search
MVAQDIKLEYDRRANMFGQNPNFATSSAWPQQSSTHSSASLAVQPSVIDGGSFLNAPLQD
STNAYSPNMSFSNSSGLSLSSQTHVGFPMADHIPSTSTQNPHSGAVVTHQQNNTVTNVHN
RSLQRESGTSPLRKLSVDLIKTYKGINESYYARKAKRRHEQEHHTHGLHATTLSEHHHTA
PPPKQAVSLNQQITSNLIQQSHPQHVHHSIFSQAASVPSLLHHLHVQVVENPRSGSHNNG
YDDDNHDYIIHPGELFSNRYQIACPLGKGSFGQVAKAYDTVEQQDVAIKIIKNKKPFHDQ
AQIEIRLLEMMNSQESESKHYVVKLKTHFMWRNHLCLVFELLSYNLYDLLRNTDFHGVSL
NLTRKFGQQLASTLMFLSSPQLNIIHCDLKPENVLLCNPKRSAIKIIDFGSSCQLGHRIY
QYIQSRFYRSPEILLGLQYDTAIDMWSLGCILVEMHTGEALFAGTCEHDQMMRIIEVLGM
PPNHMIEAAPAEKRNKFFEKSDDGNYLCKESRENKRYRSPGSRKLADIIGVDTGGPGSRR
LGECGHTPEEYTKFKDLVERMLTFDPRERIGPYAAVRHPFFSRRSDECVTLGSAIASHSR
TLQQPVTVSNVQVAQPHFIEEHSVSQMDCADSIAHSQRIHLPQLNQVLGQPSNYQQQTGS
TNQNLFQIAQPFGLLPQQMQQGPNQNQQQHQQSNSIISSTEHQLQAPPHFVSSLQNSIWT
SPEQGDDTRYDHHSQPSSNLQPSQRNSLLPQSRNLSFDGTVGNGQVSHQRPIQSSTNGAR
TNPTSVLFPNNFIPQAQQQQQTAQTGLSSNSANADFS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggttgctcaggacataaagctggaatacgatcgaagagcgaacatgtttggacaaaat
ccaaattttgcgacatcgtcagcttggcctcagcagagctctacacatagttcagcatcg
ttggcagtgcaaccctctgtcattgatggtggctcgtttctgaatgctccgctccaggat
tcgactaatgcctactctccaaacatgtctttcagcaatagttctggtttgtcgctgtct
agtcagacacatgtgggctttcctatggctgatcatattccatccacctctacccagaat
cctcatagcggtgctgtggtcacgcatcaacagaataatactgtaacaaatgttcacaat
cgctctttacaacgcgaatccggcacttctcctttgagaaagttaagcgttgatttgatt
aaaacctacaaaggcatcaatgagagttattatgcacgaaaggcgaaaaggcgacatgag
caagagcatcatacacatggacttcatgcaacaactctttccgaacatcatcatactgca
ccaccacccaaacaagccgtttcactcaatcaacaaattacttcaaatttgatacaacaa
agccatccacaacatgtccatcattcgatattttctcaagctgcttctgtcccttcattg
ttgcatcatttgcatgtgcaggttgttgaaaacccacgttctggaagtcacaacaacggt
tatgacgatgataatcatgactatatcatacatcccggtgaacttttcagtaataggtat
cagattgcatgtcctcttggcaaaggttcttttggacaagttgcaaaagcgtatgatact
gtggagcagcaggatgtcgctatcaaaattataaaaaacaaaaagccattccatgatcaa
gctcaaattgaaatccggttgcttgaaatgatgaacagtcaagaatctgaaagcaaacat
tacgttgtgaaactaaaaactcacttcatgtggcgtaatcacttatgccttgtttttgaa
cttctttcgtataatttatacgacttattaagaaatactgatttccatggtgtttcgctg
aatctcacaagaaaatttggacaacaattggccagtacattgatgtttctttcatcgcct
cagctaaatatcatacactgtgatttgaaaccagaaaatgttttgttatgcaatccaaaa
cgttctgcaatcaaaataatcgattttggttcatcatgtcaacttggtcatcgtatttac
caatacatacagtcaagattttatcgttcacctgaaattctgttgggtttgcagtatgac
acagccattgatatgtggtctcttggatgcatactggttgaaatgcatactggtgaagca
ctattcgctggtacttgtgagcacgatcaaatgatgcgcataattgaagtgttgggtatg
ccaccaaatcatatgattgaagctgcgccggcagaaaaacgtaataaatttttcgagaaa
agtgatgatgggaattatctgtgtaaagaatcacgagaaaacaagcgttatcgatcacca
ggatcacgcaagttggccgatatcatcggtgtagacacaggtggaccaggaagtcgacgc
cttggcgaatgtggtcatactcctgaagaatatacgaagttcaaggatcttgtggaacga
atgttgacgtttgatccgcgggaacgtattggaccatacgctgcagttaggcatcctttt
ttctcacgtagaagtgatgagtgtgtgactctgggttctgctatcgcttcgcattccaga
accttgcagcaaccggttacagtatccaatgttcaggttgcccaacctcattttattgag
gaacactcagtcagtcagatggattgcgcggattctatagctcattcacaacgtatacat
ttgccgcaacttaaccaggttcttggtcaaccgagcaattaccaacaacaaacaggatca
acaaatcagaatttatttcaaattgctcaacctttcggtttgttacctcaacaaatgcaa
cagggaccgaatcaaaatcaacaacagcatcagcaaagcaattcgattatttctagcaca
gaacatcagttgcaagctcctccacattttgtatctagcttgcagaattcaatttggaca
tcccctgaacagggtgacgatacacgatatgaccatcattctcagccgtcatcaaatctt
caaccatctcaaaggaattcacttttgccacaaagtcgcaatctaagctttgatggcaca
gtagggaatggtcaggtatcacatcagcgtcctatacagtcttcaacaaacggtgctaga
acaaatccgacatcggttctgtttcctaacaactttataccacaagcccagcaacaacaa
caaacagcccaaactggtttatcatcaaattcagcaaatgccgatttctcataa

DBGET integrated database retrieval system