KEGG   Brugia malayi (filaria): Bm1_38035Help
Entry
Bm1_38035         CDS       T01050                                 

Definition
acetyltransferase, GNAT family protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bmy  Brugia malayi (filaria)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Bm1_38035
Enzymes [BR:bmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Bm1_38035
Transcription machinery [BR:bmy03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Bm1_38035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 731 aa AA seqDB search
MKLWPEGELLDEKSWKKLAMHTRCSLCHCRGWKLMCDSENPYVITSAFLDDVLFSTPCET
CRHSLGRHLDRLREKKRNDIRKLLFMMSDAEKMQERLIGDEPSEILQIVKQTQRTLTKEI
ANGSCERLIASSFGFPPFEPISIEDIVSHFVVSKSTGKQKELENIVQTASNFLCTINDWN
IPPVKIMQEKLLCSNLLSYRIIYARWLRFCFLPKKHGSLRPYCVIKIFGRKFLITLLPFF
VIDVKEHTSSLKDQVTGELIDFVSDLRKNLNCHDSVTDSSTMLTFPEGVPRPTHKRGCSI
WAADPHLDMTADFLEADLAFQGSEQSNSTMHLEMRREFDESLMVRFIARMELTCRVSKSL
VHKMDAFEVDVARSEVSRLEEYNGVISFHVISNNFDWHQSRQKLTWLLQLQCLFSTQLPR
MPKEYITRLVFDSRHKNLVIVKKERGVIGGICFRQFPAQGFIEIVFCAVTANEQVKGYGT
RLMNHLKDYHVGACHIYHFLTYADEFAVGYFKKQGFSEKIAMDKKQYHGYIKDYEGATLM
GCQLHPWIVYTSFAVFLKRLHDLYRNAVKESFFKEEKKCAGIENVFLWHAGSLVPYAELP
GLEQCEDKSMPHEELEYKIRNILHKLRTDKSSWPFLKPVNAEEVPEYYGYIKFPTDLKTM
NERCRAKYYVHERLFVADLRRLFSNCFKFNAPKTLYYKAGYDLAEIARKLCQKAFPHLDI
YPELPDAKPEL
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaagttatggccagaaggcgagttgttggatgagaaaagctggaaaaaactagcgatg
catacgaggtgctctctgtgccactgtcgtggttggaaattaatgtgtgacagtgagaat
ccgtatgtgataaccagtgcttttcttgatgatgttctcttttcgacaccttgcgaaaca
tgcaggcactctcttggaagacatttagacaggttacgagagaagaaaagaaatgatatt
agaaaattgttgttcatgatgtcagatgcagagaagatgcaagaaaggctgattggggat
gagccttctgaaattctgcagatcgttaagcaaactcagagaactttaacaaaagaaatc
gctaacggtagttgtgaacgattaattgcatcttcctttggatttccgccgtttgagccc
atatcgattgaagacattgtttcacatttcgttgtcagcaaaagcactgggaaacaaaag
gaactggaaaatattgtacaaacagcatcaaatttcttatgcacgataaatgactggaac
ataccacctgtaaaaataatgcaggaaaaattgttgtgttcaaatctgttgtcttatcgt
atcatttatgcaagatggttacgattctgtttcttaccaaagaagcacgggtcgcttcga
ccatattgtgttatcaagatatttggtcgcaaatttctaatcactttgcttccatttttc
gtaattgacgtgaaagagcatactagttccttgaaagatcaagtcaccggagaactaatt
gattttgtatccgatttgagaaaaaatttaaactgccatgattcagtgacagattcatcg
acaatgcttacttttccggaaggagttcctcgtcctactcacaaacgaggatgttccatt
tgggctgctgatcctcatctagatatgactgcagattttcttgaagcagatttagccttt
caaggatctgagcagtcaaattcaaccatgcaccttgaaatgagacgtgagtttgatgaa
tctttgatggtacggttcattgctcgtatggaattaacatgtagggtatcgaaatctttg
gtgcacaaaatggatgcttttgaagtagacgttgctagaagtgaagtgtcgcgattggaa
gaatataatggtgtcatttctttccatgtaatttcaaataattttgactggcatcagagc
cgtcaaaagcttacatggttattgcaactgcagtgtttgtttagtacacagttgcctcgc
atgcctaaagaatatatcacgagacttgtattcgacagtcgtcacaaaaatctggtcatc
gtcaaaaaagagcgaggcgttattggaggcatttgctttaggcaatttccagcacaaggg
tttatcgaaatcgtattttgtgctgtaactgcgaatgaacaggtgaaaggttatggtact
cgtttgatgaatcatttgaaagattatcatgtgggagcatgtcatatatatcacttcttg
acatatgcagatgaatttgctgttggttatttcaaaaaacagggtttttccgaaaaaata
gcgatggacaaaaaacagtatcatggttacatcaaagactacgaaggggcgacgttaatg
ggctgccagttacatccgtggatagtttatacaagttttgcggttttcttgaaacgtctt
catgatctctaccgaaatgctgtgaaagaaagcttcttcaaggaagagaagaaatgtgca
ggaattgaaaacgtctttctgtggcatgcaggttcattagtcccttatgccgaattacct
gggttagaacaatgtgaagataaatcaatgccgcatgaagaacttgagtacaaaattcga
aacattcttcataaactgaggactgataaatcatcatggccatttctaaaaccagtgaat
gcggaagaagtcccggaatactatggttacattaaatttcctactgatttaaagacgatg
aatgaacgctgtagggcgaagtattatgtgcacgaaagactgtttgttgccgatcttcga
cgattatttagcaactgttttaaattcaatgcacctaaaacgttgtattataaagcagga
tatgatttggcagagattgctcgaaagctttgtcagaaagcatttccacatttggatata
tatccagaacttcctgatgcaaaacccgaattgtag

DBGET integrated database retrieval system