KEGG   Brugia malayi (filaria): Bm1_38280Help
Entry
Bm1_38280         CDS       T01050                                 

Definition
associated molecule with the SH3 domain of STAM, putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:bmy04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 345 aa AA seqDB search
MERSVDVICDPRLRMRIILNMAATQEVSPSVPINRYYRSLNEMYRVAGFCIEDKDYERAF
IYYMRFVSLAVESLPNHKQYNGFSSAEKAKAEAVLGDAFVKAESLKEQLKKKYEEEAVLA
RQSAKKTTADNVAVIGKNMSVRDVVARNRFLEIVDHKKSGSAAVMFDSRNLAHKEVVVAA
DLVENFVQLAQVNTNRNVETCAILCGSLITGGVCRITHAVIPKQTGAADSCDTHNEEEVF
AYQDANNLITLGWIHTHPSQTAFLSSVDLHTHCSYQLMLSEAVAIVVAPKFNEVGIFRLS
ERGMKEINECRKVGFHPHENSSALFFYCHDIRFENSLTATVVDLR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaagtgtagatgtgatatgcgacccgaggcttcgaatgcgaattatcctgaat
atggcggcaactcaagaagtgagcccatcagtccctattaatcgttattaccgaagtctg
aatgaaatgtatcgtgttgctggcttttgtatagaagataaagattacgaaagagcattt
atttattatatgcgttttgtgagcttagcggtcgaaagtttaccaaatcacaaacagtat
aatggcttttcgtcggctgagaaagccaaagctgaagcagtgcttggggatgcgtttgtg
aaggcggaatcgttaaaggaacagctgaaaaagaaatatgaagaagaagcagttctagca
agacagagtgcaaagaagactaccgctgataatgtagctgtgattggaaaaaatatgtcg
gttcgtgatgttgtagcacgtaatcgatttcttgaaatagttgatcacaagaaatcaggt
tctgcagcagtcatgttcgatagcaggaatcttgcccataaggaggttgtcgttgcggcc
gaccttgtggaaaattttgttcagctagctcaagttaacacgaaccgtaatgtagaaaca
tgtgcaattttgtgtggctcactgatcactggtggagtgtgtcgtataacacatgccgtg
ataccaaagcaaactggcgctgctgatagctgtgatacacacaacgaagaggaagtattt
gcatatcaagatgccaataatctgatcactctgggatggatacatactcatccatcgcag
acagcgttcctttctagtgttgatcttcatacgcactgttcctatcagctgatgttgtca
gaagccgttgcgatcgtcgttgctcctaaattcaatgaggtgggtatttttcgtttgtca
gaacgtggcatgaaggaaattaacgaatgccgtaaagtaggttttcatccacatgaaaat
tcttcagctctgtttttttattgtcatgacatacgttttgaaaattcgctaacagcaact
gttgttgatttgcgatga

DBGET integrated database retrieval system