KEGG   Brugia malayi (filaria): Bm1_38280Help
Entry
Bm1_38280         CDS       T01050                                 

Definition
associated molecule with the SH3 domain of STAM, putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Bm1_38280
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Bm1_38280
Peptidases [BR:bmy01002]
 Metallo Peptidases
  Family M67
   Bm1_38280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 345 aa AA seqDB search
MERSVDVICDPRLRMRIILNMAATQEVSPSVPINRYYRSLNEMYRVAGFCIEDKDYERAF
IYYMRFVSLAVESLPNHKQYNGFSSAEKAKAEAVLGDAFVKAESLKEQLKKKYEEEAVLA
RQSAKKTTADNVAVIGKNMSVRDVVARNRFLEIVDHKKSGSAAVMFDSRNLAHKEVVVAA
DLVENFVQLAQVNTNRNVETCAILCGSLITGGVCRITHAVIPKQTGAADSCDTHNEEEVF
AYQDANNLITLGWIHTHPSQTAFLSSVDLHTHCSYQLMLSEAVAIVVAPKFNEVGIFRLS
ERGMKEINECRKVGFHPHENSSALFFYCHDIRFENSLTATVVDLR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaagtgtagatgtgatatgcgacccgaggcttcgaatgcgaattatcctgaat
atggcggcaactcaagaagtgagcccatcagtccctattaatcgttattaccgaagtctg
aatgaaatgtatcgtgttgctggcttttgtatagaagataaagattacgaaagagcattt
atttattatatgcgttttgtgagcttagcggtcgaaagtttaccaaatcacaaacagtat
aatggcttttcgtcggctgagaaagccaaagctgaagcagtgcttggggatgcgtttgtg
aaggcggaatcgttaaaggaacagctgaaaaagaaatatgaagaagaagcagttctagca
agacagagtgcaaagaagactaccgctgataatgtagctgtgattggaaaaaatatgtcg
gttcgtgatgttgtagcacgtaatcgatttcttgaaatagttgatcacaagaaatcaggt
tctgcagcagtcatgttcgatagcaggaatcttgcccataaggaggttgtcgttgcggcc
gaccttgtggaaaattttgttcagctagctcaagttaacacgaaccgtaatgtagaaaca
tgtgcaattttgtgtggctcactgatcactggtggagtgtgtcgtataacacatgccgtg
ataccaaagcaaactggcgctgctgatagctgtgatacacacaacgaagaggaagtattt
gcatatcaagatgccaataatctgatcactctgggatggatacatactcatccatcgcag
acagcgttcctttctagtgttgatcttcatacgcactgttcctatcagctgatgttgtca
gaagccgttgcgatcgtcgttgctcctaaattcaatgaggtgggtatttttcgtttgtca
gaacgtggcatgaaggaaattaacgaatgccgtaaagtaggttttcatccacatgaaaat
tcttcagctctgtttttttattgtcatgacatacgttttgaaaattcgctaacagcaact
gttgttgatttgcgatga

DBGET integrated database retrieval system