KEGG   Brugia malayi (filaria): Bm1_39045Help
Entry
Bm1_39045         CDS       T01050                                 

Definition
Transcription factor Tfb2 family protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
bmy  Brugia malayi (filaria)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Bm1_39045
  Replication and repair
   03420 Nucleotide excision repair
    Bm1_39045
Transcription machinery [BR:bmy03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Bm1_39045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 465 aa AA seqDB search
MKIITKARILVVPNMEIRCIRNDSSNASNLVCELKGAQVLLGWRAWSSPDFEAAVINHIN
ALKKLKIIIGDEEVMLNQVYRRAYLKATRIGLCKASELSVVTDCDEKTRKSANKDLGKKA
VERWECILHYLALPSQKSEQGVSGTTKRLFRSAGLTSSGNDDGDIEITSAGFQFLLLNRP
EQIWTYLLHYFHMQEVAGIDIVKELDFLFKLTLYSGSTCGGTRVVNGSDKERPTGSRAFI
IDENWPETIKDFLMHLRELGLVFIRKRKDGFFFLTPLLNHLTGISNTSEAGMENRNQNGF
VIVETNYRVYAYTDSNLQLAILSTFTEMLYRFSDMSVGVLSREAVRRAFQVGITAAQIIA
FLSRNAHPITCAVTTEYGRMIQSVPITVVDQIQLWEDERRRLTFCSAAVYSSFESEKEYF
GLKGYVISQNILLWCHDVQRLMVITEEGHENVKVWWKMKTGKNGS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagataatcaccaaagcacgaatactggttgtgccaaacatggagatacgctgcatt
cgaaacgattcttcgaatgcttcgaatttggtatgcgaattgaaaggggcccaagttttg
ctcggttggcgtgcgtggtcatctccagatttcgaagcagcagtgataaatcatatcaat
gcattgaagaaactaaagataattattggagatgaagaagtcatgcttaatcaggtatat
cgtcgtgcataccttaaggcaactcgtattggattatgcaaagcatcagaactcagtgta
gttacagactgtgatgagaaaactcgaaaatcggcaaataaagatctcggaaaaaaagct
gttgaaagatgggaatgcatattacattatttagctttaccgtctcagaaaagcgaacaa
ggtgtcagtggtactactaaaaggctttttaggtctgcgggtctaactagcagtggaaat
gatgatggcgacatagaaataacatccgccggttttcaatttcttttattaaatcggccg
gaacaaatttggacctacctcctacattattttcatatgcaagaagtagctggtatcgat
atcgtcaaggaacttgattttttattcaaattaactttatattctggtagtacatgtggt
ggtaccagagtggttaatggttcggataaagagcgacctaccggtagtcgggcatttatt
atcgatgaaaactggcctgaaactatcaaggattttctgatgcacctcagggaattggga
ttagtttttataaggaagcgaaaagacgggtttttttttctaactcctttgctcaatcat
ttgaccggtatttccaatacatctgaagcaggcatggaaaaccgtaatcagaacggtttt
gtgatagtggaaacaaattatcgtgtttatgcatacacagattcaaacttacagcttgca
atactctcgacatttacagaaatgctttacagattcagcgatatgtctgtgggtgtgctt
tctcgtgaagctgtaagaagagcatttcaggttggtataacagcagcacaaattatagca
tttctgagtagaaatgctcatccaataacttgtgcagtaacaactgaatatggaagaatg
atacagagtgtacccataactgtggtagatcagatacaactttgggaagacgaaaggcga
cgtttaacattctgcagtgctgctgtttattcgtcatttgaatctgaaaaagagtatttc
ggtttgaaaggatacgtcatatctcagaatatcttactatggtgtcatgatgtacagagg
ttgatggttattacagaagaaggacatgaaaatgtgaaagtgtggtggaaaatgaaaacc
ggtaaaaatggttcttaa

DBGET integrated database retrieval system