KEGG   Brugia malayi (filaria): Bm1_39250Help
Entry
Bm1_39250         CDS       T01050                                 

Definition
protein disulphide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Bm1_39250
Enzymes [BR:bmy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bm1_39250
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Bm1_39250
  Exosomal proteins of colorectal cancer cells
   Bm1_39250
  Exosomal proteins of bladder cancer cells
   Bm1_39250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MFRLVVTLSLLLQFALHPVAHDASVEEDEGVLVLTKDNFDDTVAAHEFILVEFYAPWCGH
CKALAPEYAKAAQLLKKEESPIKLAKCDATVHGELASKYEVRGYPTLKLFRSGKPQEYGG
GRDAASIVAWLKKKTGPAAKTILSADDVKDFQENNEVCVIGYFKDTESMNAKVFLEVAAG
FDDIPFGITTENDAARQIELESEGVVLLKKFDEGRAEFSEKLVADQLKTWIQAQRLPLVS
EFTQDTAPIIFGGDIKSHNLLFISKESSEFEKLEKEFRAAAKKFKGKVLFVIINTDVEDN
ARILEFFGLKKEDLAALRLISLEEDMTKYKPEFKEITAENIIQFTEMYLAGKLKSHLMTQ
DIPSDWDKNPVKVLVGKNFDDVAKDSKKNVIVLFYAPWCGHCKQLMPTWDKLGEKYKDHD
TILIAKMDATANEVEDVKIIDFTGERTLEGLTKFLESGGKDGAGLSDQEKAEAEAENEDE
EAQHTEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggttggtcgtcacccttagcctgttgcttcagtttgcactacacccggttgcc
catgatgcaagtgtagaggaggatgaaggagttcttgtacttacaaaggataattttgac
gacacggtagcagcacatgagtttattctggttgagttctatgcaccatggtgtggacat
tgcaaggccttggcacctgaatatgcaaaagcagcgcagttgctaaagaaagaggagagt
ccaatcaagcttgcaaagtgcgatgcgaccgtacatggtgaacttgcttcaaagtacgag
gtgcgtggttatccgactctgaagttattccgttctggtaaaccacaggaatatggtggt
ggacgagatgcagcgtccatcgtcgcttggctaaaaaagaagacaggtccagcagctaaa
accatactctcagctgacgatgtaaaagacttccaggaaaacaatgaagtgtgcgtcatt
ggctactttaaggatactgaaagcatgaatgcaaaagtttttctggaagtggctgctgga
ttcgatgatataccattcggtatcaccacggaaaatgatgcagcaagacaaatagaattg
gaaagtgaaggcgttgtgttgttaaagaaattcgatgagggacgagccgaatttagtgag
aaattagtagctgatcaacttaagacttggattcaggctcaaagattaccgcttgtgagt
gaattcacacaagatactgcaccaattatcttcggtggtgatattaaatcacacaatctc
ctattcatttcaaaagaaagctctgaatttgagaaactagagaaagagttccgcgcagct
gcgaagaaattcaagggcaaggttctttttgtcatcattaatacggacgtggaagacaat
gctcgtattctggaattctttggtctcaaaaaggaagatttggcagcactgagattgatc
agtctagaggaggatatgactaaatacaaacccgaattcaaagaaattacagcagaaaat
attatacagtttacagaaatgtatcttgctggtaaattgaaatcacatctaatgactcag
gatattcccagtgactgggataagaatccagtaaaggtactagttgggaagaactttgac
gatgtcgcaaaggattccaagaaaaacgtcattgtgctattctacgctccatggtgtgga
cactgcaaacaacttatgccaacatgggataagttgggtgaaaaatataaggatcatgat
actatactgattgctaagatggatgcaacagcaaatgaagtggaagatgttaaaataatt
gattttaccggtgaaaggacattggaagggctgacgaaatttttggaaagtggaggtaag
gatggtgctggtttatcagatcaagagaaggcagaagccgaagcagaaaatgaagatgaa
gaagcacagcatactgaattgtga

DBGET integrated database retrieval system