KEGG   Brugia malayi (filaria): Bm1_39990Help
Entry
Bm1_39990         CDS       T01050                                 

Definition
Dual specificity mitogen-activated protein kinase kinase 6
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_39990
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Bm1_39990
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Bm1_39990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 346 aa AA seqDB search
MPEPESPPNLDLDDKCMMKFSEDGDEVQVRAQDLEKIEELGRGAYGVVEKMRHCQTNTVI
AVKRIHSQINDESQKRMLVELQACMKSDCCPQMVRFYGAMFREGDVWICMEVMDTSLDKF
YRMCFDSGGPLPEMFIAKCALSVVEGLNFMKEQMNLIHRDVKPSNILLNKQGAVKICDFG
ISGHLTNSVAKTVNAGCKPYMPPERIEGEKKVAYDVRADVWSLGITLVEIASGSHPYSKW
KTPFEQLKQVVHEPAPRLSHSLGFGDNFQDFVAQCLTKDYNNRPKYPDLLVHRFLDDARN
DHKFSMGAFVQNILGVAERERESVLQNFNTETPVPKLVGPSENHNR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacctgaaagtccaccaaatctcgatcttgacgataaatgcatgatgaagttt
tcggaagatggtgacgaggttcaagtacgagctcaagacttagagaagattgaagaactt
ggaaggggagcatatggggttgttgaaaaaatgcgtcactgtcaaacgaatactgttata
gctgttaagcgtattcattctcaaataaatgatgaaagtcagaaacgaatgcttgtggaa
ttacaagcttgcatgaaaagcgattgctgtccacagatggtgcgtttttacggagcaatg
tttcgtgaaggcgatgtatggatttgcatggaagtaatggatacatcattggataaattt
tatcgaatgtgtttcgattcaggtggtcctctgccagaaatgttcatagctaaatgtgct
ctttcggttgttgagggactgaattttatgaaggagcaaatgaatctaatacatcgggac
gttaagccatcaaatatactgctcaataagcaaggagcagtgaaaatttgtgattttggc
atttcaggtcatttgacaaattcagttgcaaaaacagtgaatgcagggtgcaaaccttac
atgccaccggaaagaattgaaggtgaaaagaaggttgcttatgatgttcgagctgatgtg
tggagtttgggtattacgctggtggaaatagcctcaggatcccatccgtattccaaatgg
aaaacgccatttgaacaattgaaacaggttgttcatgaaccagcaccaagattgtctcac
agtttgggattcggcgataattttcaggattttgttgctcagtgcctgacaaaagattac
aacaacaggccgaaatatccagatctgttggttcatagattcctggatgacgctcgtaat
gatcataaattttcaatgggagccttcgtccaaaacattttgggtgtagcagaacgcgaa
cgcgaatccgttcttcagaattttaatactgagacgccagttccaaaactcgttggtcca
tcagaaaatcataatcgataa

DBGET integrated database retrieval system