KEGG   Brugia malayi (filaria): Bm1_40160Help
Entry
Bm1_40160         CDS       T01050                                 

Definition
phospholipase C homolog
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bm1_40160
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    Bm1_40160
   04070 Phosphatidylinositol signaling system
    Bm1_40160
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Bm1_40160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1197 aa AA seqDB search
MTASVVERLVNAIHLNAAPPKPNSLLVFVCKLASSHPNSSTVHDFVIGDEPIALFRPELE
KLQHILHFPEELAFQLSATEYQLFYGMQPIDYVHYVSCDLTSVPVANNPSPVQNLVKRLS
EISSWVTHLILSMPTSEERKITLISIFRMIDTCWNIGNFNAAVEILMGLKSEKLRSFWLS
MRSEEKNKYEQLCDALLPSNQAALSSIYREAIQRALRMPQCRLIPFFGIFLRDLYAIVND
MPSVVITDDENKERLELMNKQTGDNRCTSEIGVSGLLNADKISLVAVVLDNLELFYRHYK
NVTSFVMDPTKPSIGKENPKPKGYHPVQPVKGVARNVTLVPLDTNRFDLDVIQRLHHGTT
VIHCDPYTSRSTLCMLKLDATCGLLSWHKVGYLGTKETKDKDAYISSVTRIQSAKLQSTT
PLESGNPPSSPSLRPAGAACTMLECGFLKLSYIKSVENVTSHDINIENIYRRYCNEDMSV
QMHCWTINFGCYLSDNEFLYFIAPEKSAQCWIIGLTAIVNYFLEQQKCADRRVLWLRKLY
LQLYNNYEQDNVIDEGVISTVQPHEALQAFGGRAKEQRALGLQSIVSKSLQSGTIRSAEV
TAKKGRLKQMTSAVTRQMKFANRSAHPQPFISLKAQYQSVRNRITGRQFTVSDPSISKMP
RSHDSSSSVDTISLSSWYKSRKLSARTLANFWSEKTKNRTKSSENTSQNPAFSKEFLLSS
KSCEEEYAEKPLTLFEFIELYKSFNANMRTDLKDIFNDFLVAYGCGNANAVECEKNQKFS
QIESPLWDTEFIPNDVLTRNTFTTQHISEKQQKVYNALALASLNSMDLTDTSRYSFLTPA
MLKQFIEIHQMEIVDEDYAIKIIQEHEPNSIYRSSQQLSFEGFVRYITDSTNYAFVPEAI
KPDQDILHYPLNYYYICSSHNTYLTGHQLKGESSTEMYRQVLLTGCRCVELDCWDGENGL
PQIFHGHTLTSKIGFREVLTIIKKSAFATSNLPVILSIENHCSLQQQARMAQMFRNYLGE
ELVTYFLFEADYSNSPRLPSPWQLQNKILIKNKKLVAEPSVGLRVDKYFIKNESDAVMEQ
TDGFYGTDEDDLEEFYDDLDDEEAGSESLRIINRLSRGTLHESSGETEEEHKYSVSKSEH
ETSASFNWGADDKLSSFNQEIVLQRPIKKISGTPVAPELSDLVNYMQTTKFKVGLTV
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atgacagccagtgttgttgaacgacttgtcaacgccattcatttaaatgcagcacctcca
aagccgaactctttacttgtattcgtctgtaagttagcttcatcacatccaaacagttcg
acagtacatgattttgtaattggtgatgaaccaattgctttatttcgaccggaacttgag
aaactacaacatatattacattttcccgaagaattagcttttcagttgtcagcaaccgaa
tatcaattattctatgggatgcaaccgatagattatgtccattatgtaagctgcgattta
acttcagtaccagttgcaaacaatccaagtcccgttcaaaatcttgttaagcgcttatct
gagataagttcgtgggtaacccatcttatacttagcatgccaacatctgaagaacggaaa
ataactcttatttctattttccgaatgatcgatacgtgctggaacattggcaatttcaac
gcagccgttgaaattctgatgggactgaaaagtgaaaaattgcgatcattttggttgtca
atgagatctgaggaaaagaataaatatgaacagctttgtgatgctctgttacccagtaat
caggctgctttgtcgagtatttatcgagaagcgattcaaagagctttacgcatgccacag
tgcaggctgattcctttttttggtatcttcctgcgtgatttatatgcaatagtaaacgac
atgccaagcgttgtgataactgatgatgaaaataaagagaggcttgagcttatgaataaa
caaactggcgataatcgttgtacgtctgaaattggagttagtggtttgttaaatgctgat
aagattagtttggtggctgtggtgcttgataatttggaactgttttaccgccattataag
aatgtaaccagttttgtcatggatcctacgaaaccaagtattgggaaagaaaatccaaaa
cctaagggttatcatccagtgcaacctgtcaaaggtgttgcgagaaatgtcactttggta
cctttggatacgaaccgtttcgatctggatgtgatccaaaggcttcatcatggtaccaca
gtcattcattgtgatccgtatacaagtcgcagcaccctttgtatgctaaaactggatgcc
acttgtggcttgttgtcatggcataaagttggttatttgggaacaaaggagacaaaagat
aaggatgcatatatctcatcagtgacacgaatacaaagtgcaaaactgcaaagtacgaca
ccactagaaagtggaaatcctccttcatcaccaagtttacgaccagctggagctgcctgt
actatgttggaatgtggctttttaaagctttcctatattaaatctgttgaaaatgttact
tcacacgacatcaacattgagaacatttaccgacgctactgcaatgaagatatgtctgtg
caaatgcattgctggacaataaattttggttgttatttgtctgataatgaatttttgtac
tttatcgcaccggagaaaagcgctcagtgctggataatcgggttaacagctattgtaaac
tacttcctagaacagcaaaaatgcgcagatcgacgagttttatggcttagaaaactgtat
ttacaattgtataacaattacgaacaggataacgtgatcgatgaaggcgtgatatctact
gtacagcctcatgaagctctacaagcttttggtggccgagccaaagagcagagggcttta
ggtttgcaaagtatcgtttcgaaatcacttcaatcaggaacgattcgttctgcagaggtt
acggcaaaaaaaggtcgtttaaaacaaatgacaagtgctgttactcgccaaatgaaattt
gcaaaccgtagtgctcatccacaaccatttatatctttgaaggcgcaataccagtcagta
cgaaatcgcataactggcagacagtttactgtatcagacccaagcatatcaaaaatgcct
cgatcacatgacagttcctcatcagtcgatactattagtctctcctcttggtacaaatcc
agaaagttatcagcaagaactttagccaatttctggtctgagaagacaaaaaataggaca
aaaagttccgaaaatacaagtcaaaacccagctttctctaaggagtttttgctgtcctcg
aaatcgtgtgaagaagaatatgctgagaagcccttaacattattcgaattcattgaattg
tacaaatcatttaatgcaaacatgcgaacagatctaaaagatattttcaatgatttcctc
gtggcatatggatgtggcaacgcaaatgcagttgaatgtgaaaaaaatcaaaaattttca
caaatagaatcaccgctttgggatactgagtttataccaaacgatgtccttacaaggaat
acttttacaactcagcatatcagtgagaagcaacaaaaggtatacaacgcactagctctt
gctagtttaaatagtatggacctaacggatacatcaagatattcatttttaactcctgca
atgctgaaacagtttattgagatacatcagatggaaattgtggatgaagattatgcaatc
aaaataatacaggaacacgaaccgaattcaatttaccgaagtagtcagcagctttcattt
gaaggatttgtacgatatataactgactcaacgaattatgcgtttgtgcctgaagcaatc
aaacctgatcaggatatacttcattatccattaaactattactatatttgctcaagtcac
aatacttacctcacaggtcatcagctgaagggtgaatcatccaccgaaatgtatcgccag
gtactattgacaggctgtcgttgcgttgaattagattgctgggatggtgaaaatggcctg
ccccagatattccatggccacactttgacatctaaaattggctttcgtgaagtacttact
atcattaaaaaaagtgccttcgctaccagcaatttacctgttattttatcaatcgaaaat
cattgctcacttcagcagcaagcgagaatggctcaaatgtttagaaattacctcggtgaa
gaactagttacgtatttcttgttcgaagctgactatagtaattctccacgacttccatca
ccgtggcaattgcagaataaaattttaattaaaaataagaaattggtcgcagaaccaagt
gtcggactgcgtgtggataagtactttatcaaaaatgaaagcgatgcggttatggagcag
actgatggattctatggaacagatgaagatgatcttgaggaattttatgatgatttggat
gacgaagaagcaggttcggaaagtctgaggataataaatcgattgtcaagaggtacactg
catgaatcgtccggtgaaactgaagaggagcacaagtactctgtatccaaatcagaacat
gagacaagtgcatcattcaactggggagcagatgataaactatcatcatttaatcaagaa
atagtgttgcagaggcccattaagaagatatcaggaaccccagttgcacctgaattatca
gatttggtgaattacatgcagactaccaaattcaaggtaggattaactgtttga

DBGET integrated database retrieval system