KEGG   Brugia malayi (filaria): Bm1_40440Help
Entry
Bm1_40440         CDS       T01050                                 

Definition
Protein-tyrosine phosphatase containing protein
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_40440
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     Bm1_40440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 393 aa AA seqDB search
MVASYVSMRNCSLRERRGSSVSLTIDPAQFPSSTLQISPIHEDIAEESELRKSRRLTRYQ
LRHLDISASLSKIYGEFAALPSPSTSSCEKVAGCSQKNRHTLWPIRETRVRLSSIYRASC
NSTAEDVCRSYINANYILDSNSKLMYIAAEGPMPNTIDDFWLMVLQERTPAIVMVTNLEE
KPFGTKLPLKKCDKYWPDNHACYGEINVTVVSTNFYDGVQIRHIVLNYDDVEHHVRHIWF
TEWLDHRLPVQYITQILKVVVAMESYRNEHQRLFTHAGPIIVHCSAGIGRTCTFIAIALG
IDQLYKTPENIDVFSTVSRLRRQRFGAVQLPGQYAFIYLVLQRMERLLPEFFAQSDQDKF
PACLSFSENSKSESGNDDELLWNSQVDLLCNNF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggttgcatcttacgtttcaatgcgcaactgcagccttcgtgaaaggcgtggctcatca
gtgtcattgacaattgatcctgctcaattcccgagttcaactcttcaaatatcaccaatt
catgaagatattgctgaagaatcggaactccgtaagtcacgacgtttgacacgttaccaa
ttgcgtcatcttgatatttcagcatccctttctaagatatacggagagtttgctgccctt
ccaagtccaagtacttcgtcatgtgaaaaagttgccggttgtagccagaaaaatcgacat
acattgtggccaataagagaaactcgtgtacgactgtcatccatttacagagcttcatgt
aattctacagctgaggatgtctgccgaagctatatcaatgccaactatattttggattcg
aactcaaaattaatgtatatcgcagcagaaggcccaatgccgaatacaattgacgatttt
tggctaatggttcttcaagaacgtacgccagctattgtaatggtgaccaacttagaggag
aaaccttttggaactaaactaccactaaaaaaatgcgacaaatactggccggacaaccat
gcctgttatggcgaaattaatgttactgttgtatcaacaaacttttatgacggagtacaa
attcgccacatcgttttaaattatgatgatgtggagcatcacgtaaggcacatttggttt
acggaatggctagatcaccgtttgcctgtgcaatacatcactcaaattttgaaagtagtc
gttgctatggaaagttatagaaatgaacatcaacgattgtttacccatgcaggaccaatt
attgtccactgcagtgctggaatcgggcgaacctgtacatttatcgcaatagctttggga
attgatcagctttataagactcctgaaaatattgacgtcttttctaccgtatccagatta
cgcagacagagatttggagctgtacaacttccaggacagtatgcattcatctacttggta
ctgcaacgcatggagagactcctcccagaattttttgcacagagtgaccaagacaaattt
cctgcatgtcttagcttttcagagaattccaagtcagaaagcggaaacgatgatgaacta
ctctggaatagccaagttgacctcctttgcaacaatttttaa

DBGET integrated database retrieval system