KEGG   Brugia malayi (filaria): Bm1_40465Help
Entry
Bm1_40465         CDS       T01050                                 

Definition
Cuticular glutathione peroxidase precursor
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bm1_40465
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bm1_40465
Enzymes [BR:bmy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bm1_40465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 223 aa AA seqDB search
MSAQLLILSHMVLLQLIVAQLGPKIGKQFLKPKQCEITNQTVYDFQVQMLNGAQKSLAEY
RNKVLLIVNVATYCAYTMQYRDFNPILESNSNGTLNILGFPCNQFYLQEPAENHELLSGL
KYVRPGHGWEPHKNMHIFGKLEVNGENDHPLYKFLKERCPPTVPVIGKRHQLIYDPIGTN
DVIWNFEKFLVDKKGRPRYRFHPENWVQGTAVKPYIDELEREI
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacaacttttgattttatcacacatggtgttattgcaacttattgttgcacaa
ctaggcccaaaaattggcaaacagttcttaaaaccgaagcaatgtgaaataacgaatcaa
acagtgtatgattttcaagttcaaatgctaaacggtgcacaaaaaagtttggcagaatat
cgcaacaaagttcttttaatcgttaatgtcgctacttactgcgcatacacaatgcaatac
agagatttcaatccaatacttgaaagtaattctaatggaacgctcaatatcctaggattt
ccatgcaatcagttttacttgcaagaaccagcagaaaatcacgagttgttgagtggtttg
aaatatgtaagaccaggacatggctgggaaccacacaaaaacatgcacatttttggcaaa
cttgaagttaatggtgaaaatgatcatccgctttacaaatttttgaaggaacgttgcccg
ccgacagtgccagtaattggaaagcgtcatcagttaatatacgatcccataggtacaaat
gatgttatttggaattttgaaaaattcttggttgataagaaaggtcgtccacgttaccgc
tttcatcccgaaaattgggttcaaggaactgctgtaaagccatatatcgatgaactggaa
cgtgaaatttaa

DBGET integrated database retrieval system