KEGG   Brugia malayi (filaria): Bm1_40555Help
Entry
Bm1_40555         CDS       T01050                                 

Definition
Stress-activated protein kinase jnk-1
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Bm1_40555
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_40555
   04012 ErbB signaling pathway
    Bm1_40555
   04310 Wnt signaling pathway
    Bm1_40555
   04068 FoxO signaling pathway
    Bm1_40555
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Bm1_40555
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Bm1_40555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 549 aa AA seqDB search
MILCLQWLGSSNSGGRDDYETEAILLDSCASVLQPSYLEGVYPASMASTSTASEFYNVDI
NDTRLCVLKRYQNLRIIGSGAQGVVCAAHDTLRDEQVAIKKLSRPFQNVTHAKRAYREFK
LMNLVNHKNIIGLLNAFTPQKTLDEFSDLYIVMELMDANLCQVIQMDLDHERMSYLLYQM
LCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAGDSFMMTPYVVTRYYRAPE
VILGMGYKDNDIVLALVAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKIVEQLGTPSLM
FMRRLQSTVRNYVENRPHFPGFPFDKLFPDELFPALSSSDSRLTVDIWSIGCIFGELIRG
RVLFPGTDHIDQWSKIIEQLGTPGRDFMQKLQATVRSYVENRPRHPGLPFEILFSDNIFP
KPATNNALCPAQARDLLSKMLVIDPEKRISVDEALKHPYVYVWFDEAEVYAPPPEQYNHS
IDSRDHTVEQWKELIFKEIMQYEQTHDEYGVKKSLNCTSGAVPSSSSSFQNNEHGDCSTT
GNTLVTNGL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgattctttgtttgcagtggctgggaagttcaaattcaggaggtcgtgacgactacgag
acagaagcgattttgctcgatagctgcgcaagcgttttgcagccgtcttatcttgaaggc
gtttatccagcttccatggcttccacttccactgcttccgaattttacaacgttgacatt
aatgacacccgtttgtgtgttttgaagcgctatcagaatttaaggattatcggatctggt
gcacaaggcgtagtatgtgctgcacatgatactcttcgtgatgagcaagtcgctattaag
aagctaagtcgtccgttccaaaatgtgacgcatgctaaacgtgcttacagagagtttaaa
ttgatgaatcttgttaaccataaaaatataattggattgttgaatgcgtttacacctcag
aaaacacttgatgaattttccgatttgtacatagtaatggaacttatggatgctaattta
tgtcaagtaatacaaatggatttggatcatgaaaggatgtcctatttgttatatcaaatg
ttatgtggtatcagacacttgcatgctgcgggtatcatacatcgggatctcaaaccgagc
aacattgttgttaaaagtgattgtagtttgaaaatattggattttggtttagcacgaagt
gccggtgattcatttatgatgacgccatatgttgtaacacgttactatcgtgcacctgaa
gttatattaggaatggggtacaaagataatgacattgttttggcactagttgcagttgat
gtttggtcaacgggctgtatatttggcgaaatgattcgtggtagtgtattgtttccgggc
aatgatcatattgaccaatggaccaaaattgttgagcagcttggtactccttcactgatg
ttcatgcgtcgcttgcagtcaactgtccgaaattatgtggaaaatcgtccccatttccct
ggttttccattcgataagctgttcccggatgaattatttccagctctcagcagttctgat
tcacgacttactgttgatatatggtcgattggttgtatttttggtgaactcattcgtggc
cgagttctttttcctggtacggatcatattgatcagtggtcaaaaattattgagcagctg
ggaacaccgggacgcgattttatgcagaagttgcaagcaactgtgaggagctatgtggaa
aatcgtcctaggcatcccggtcttccatttgagattctctttagtgataacatattccca
aagccggcaaccaacaacgcactttgtccagcacaagcacgcgatttgctgtcaaaaatg
ttggtgattgatccggaaaagcgcatatcagtggatgaggctctgaaacatccgtatgtt
tatgtatggtttgacgaagctgaagtttacgctccaccaccggaacagtacaatcacagt
attgactcgagagatcatacagttgaacagtggaaggaactaatattcaaagaaatcatg
cagtacgagcaaactcatgacgaatatggagtaaagaaatcgttgaattgtacatcgggt
gctgtaccgtcgtcttcatcatcatttcagaacaatgaacatggtgattgctcaacaacc
ggaaatactttggttacaaatggcttgtaa

DBGET integrated database retrieval system