KEGG   Brugia malayi (filaria): Bm1_41250Help
Entry
Bm1_41250         CDS       T01050                                 

Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bmy  Brugia malayi (filaria)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_41250
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bm1_41250
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bm1_41250
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bm1_41250
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Bm1_41250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 384 aa AA seqDB search
MVFRSIFQQHFLLIRSKRLLSVGFDEILTKNISGKLIVTLNRPRTLNALNISMVRKLYPM
LKKCDSDSSVPFIFVKGTGGKAFCAGGDIVAVSRSAQANDPSNTVHKDFFREEYVMNYLI
GVLKVPYIAVMDGITMGGGCGLSIHGKYRIATERTMLTMPETSIGFFPDVGGTFFLSRLP
YNLGQFMALTGYRLIGADAYHMGLATHFVPSEKLKNLEDELLRTDNKLLSAEKIDYILNK
YHMKESEIPKFGLEKRLAQINYLFSGSTVESVFKKLRNNNDDFGNKLFNILSTKSPTSLK
VTFRQLQIGLXMQFPEVFTMEYRLSQRFMKSHDFHEGCRAILINKDQKPVWKPASIEEVT
DEMMDEYFAPLHEDEELIIKEFET
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggtattccgaagcatatttcaacagcattttctgcttattaggagcaaaaggttgttg
tcggttggatttgatgaaatactgacaaaaaacataagcggcaagctaattgtgacgtta
aatcgaccgaggactctaaatgcattgaacatcagcatggtgcgcaaattatatccgatg
ctaaagaagtgcgacagtgattcaagtgtaccgtttatatttgtcaaaggaacaggtggc
aaggcgttttgtgctggtggcgatattgttgctgtatcacgttctgcgcaagcaaatgat
ccatcaaatacggtgcacaaagatttttttcgcgaggaatatgtgatgaattatttgatc
ggtgtcttaaaggtaccatatatcgctgttatggatggtataacaatgggaggaggttgt
ggtctttctatccatggaaagtacaggatagcaacagaacgaacaatgttaacaatgcct
gaaacttctattggtttctttcctgatgtcggagggacttttttcttgtcacgattacca
tacaatttgggtcagttcatggctcttacaggatatcgactgataggcgccgatgcttat
catatgggtctcgctactcatttcgttccatcagaaaaaytgaagaatcttgaagacgaa
ctgctcaggacggataataaattgctttctgcagaaaagatagattatattttgaataaa
taccacatgaaggaaagtgaaatacccaagtttggtcttgaaaaacggctcgcacaaatt
aattatttatttagcgggagtacagtcgaatcggttttcaaaaaactgcgaaacaataat
gatgatttcggcaacaaactattcaatattcttagcacaaagagcccaacatcactgaaa
gtaacttttcggcaattgcaaattggtttgargatgcaatttcctgaagtttttacaatg
gaatatcgtctttctcaacgtttcatgaaaagccatgactttcatgagggttgcagagca
attcttatcaataaggatcaaaaaccggtgtggaagcctgctagtatagaagaagttacg
gatgaaatgatggatgagtactttgctcctcttcatgaggatgaagaattgattattaag
gaatttgaaacttaa

DBGET integrated database retrieval system