KEGG   Brugia malayi (filaria): Bm1_41320Help
Entry
Bm1_41320         CDS       T01050                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmy  Brugia malayi (filaria)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bmy00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmy00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bmy00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmy00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 499 aa AA seqDB search
MMQKEIDKSSEEWKSSTKRETLLGMEQELRNLIETAPPDQKEAVQKELDCFRVLFSRFLR
AKTTIEWKKIQPLPDNAIISYKELKLHDPSKDLVSDRLSKLVVVKLNGGLGTSMGCKGPK
SMISVRNDLTFLDLTLQQIQNMNRTYDVNVPLVLMNSFNTDEDTKKLLRKYKNVQVDVHS
FCQSKYPRILKESLMPIVKNVSDSDHDEWYPPGHGNFYEAFYNSGLLDKFLQDGKQFCFL
SNIDNMGATVDMNVLNFIVQEVNGHQPEFVMEVTDKTRADIKGGTLIQYEDRLMLLEIAQ
VPKDYVDEFKSVSKFRIFNTNNLWAKLNAIKRVVEQKELEMEVIVNPKHLDRGVDVIQLE
TAAGAAIKSFKGACGINVPRSRFLPVKTTSDLLLLMSNLYEIENGNLTLSHLRSFPTTPL
VKLGSFFDKVQEYLRRFQGIPDLLELDHLTVSGDVWFGRDVVLKGTVIIIANHGDRIDIP
PGTILENKIVSGNLRILDH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagaaagaaattgataagagttcggaagaatggaaatcatcaaccaaacgcgaa
actcttctaggaatggagcaggaactgaggaatctcatagaaacagcaccacccgaccag
aaagaggctgtacaaaaagaattggattgcttccgcgtcttattttcacgatttctacga
gctaaaaccactattgaatggaaaaaaattcaaccactgcccgataatgcaattatatcc
tataaagagttaaagctgcatgatccaagcaaagatttggtgtcagatcgcctgagcaaa
ttggttgttgtaaagttaaatggtggtttgggtacatcaatgggttgtaaaggtccaaaa
tctatgatttcagttcgaaatgacctcacatttctcgatttgacattgcagcaaattcag
aacatgaatcgtacctatgatgtcaatgtaccattggttttaatgaattcgtttaatacg
gacgaagatacgaagaaattgttgagaaaatacaaaaatgtgcaagtcgatgtacactct
ttttgtcagtccaaatatccgcgaatattgaaagaatcactcatgccgattgtcaaaaat
gtttctgatagtgatcatgatgagtggtacccacccggtcatggtaatttttatgaagca
ttttataattctggacttctggacaagttccttcaggatggaaaacagttctgctttctg
tcaaatattgataacatgggtgcaacggttgatatgaatgtattgaatttcattgtacag
gaagtaaacggtcatcagccagaatttgtgatggaagttactgataagactcgagccgat
attaagggtggcactctgattcagtacgaggatcggttaatgttactggaaatcgctcaa
gtgccaaaagattatgttgatgaatttaaaagcgtaagcaaattcaggatatttaataca
aacaacttatgggctaaattaaatgcaataaagcgagtagttgaacaaaaagaattggaa
atggaagtaattgttaatccaaaacatctggatcgtggtgttgatgtgatacagctagaa
actgctgctggtgccgctatcaagagttttaaaggagcatgcggaattaatgtccctcgt
tcacgatttcttcctgtcaagactacctccgatctcttgttgcttatgtcaaatttatat
gaaatagaaaatggtaacctaacattaagtcatcttcgttcctttccaacaactccactc
gtcaaattgggcagttttttcgacaaagtacaggaatatttgagacgtttccagggtatc
ccagatctgctggaattggatcatttaacagtatctggtgatgtatggtttggcagggat
gttgtattaaagggtacagtgataataatagcgaaccatggtgatcgtatagatattcca
ccaggaaccattcttgaaaacaagattgtttctgggaatcttcgaattctggaccactga

DBGET integrated database retrieval system