KEGG   Brugia malayi (filaria): Bm1_41510Help
Entry
Bm1_41510         CDS       T01050                                 

Definition
FAD binding domain containing protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 639 aa AA seqDB search
MDWLRTGLDIVDLVVLTVMLLTTIYYSWRLWIGKNSNELIESTVLPSCTSSEISVDRQTS
FVTRMKSEERKVLIIYGSQTGTAEELAGRLSKDVQNYGQKALLLDPEEMNVEDFEKIKEI
SGVLLVLFMATYGEGDPTDNAQEFYQHVLNTELNLTGVNFAVFGLGNKTYGHFNEIAKYF
NRRMEEFGATRIYSLGLGDDDGNLEEDFMRWREGFWSAVTSIFGWEIAEIGIVRQYCLEI
VKDFSVKLFTGEYGRLGSFEKQRPVNRELHGIKSDRSCRHIEFIISETKMRYEVGDHLGI
FPTNDPVKVEELGRLLEADMDLRFSLVNLDEENLKKNPFPCPCTIRTAFTHYVDICAPVK
SNVLKALAHFTSDENEKERLLLLSTANEQGLKEYGNYIQKERRSIIDILRAFPTCKPPVD
YILELLPRLQPRYYSISSSSKYSHDSLAITVIVTKYVISDRLIKGGEGSKVPIFLRKSTM
RLPHRLKTPVIMIGPGTGFAPFRGFLQERSWQKKQGQDIGPMILYYGCRHPEHDFIYEEE
LKKFVEDGVLSELHIAFSRLTAKKIYVQDKIWKNREKVWKTIENGGNIFLCGDARNMARD
VQNTFIRIFMEIGGKTEIEAQKFQKDLERKRCYQTDVWS
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggattggttacgaacagggctagacatagttgatctagttgttttaactgtcatgctg
cttacaacaatttactattcttggaggttatggatcggaaaaaactctaatgagttgata
gaatcaactgttttgccctcttgcacttcttccgaaatttcagttgatcgacaaacttca
tttgttacacgtatgaagtcggaagaacgaaaggttttaataatttatggttcacagaca
ggaacagctgaggaattggcgggtcgtctttctaaggatgtccaaaattacggtcagaag
gctcttttactcgatccagaggaaatgaatgtcgaggattttgaaaaaatcaaagaaatt
tctggtgttcttctagtattattcatggcaacatacggtgaaggcgatcccacagataac
gcgcaggaattttaccagcatgttttgaatacggaactcaatttaacaggcgttaacttt
gctgtttttggcttaggtaataaaacttatggacactttaatgaaattgcgaaatatttc
aaccgacgaatggaagaattcggtgctacacgtatttacagccttggcctcggtgatgat
gacggaaatctggaagaggattttatgagatggcgagaaggcttttggtctgctgtgaca
agtatttttggttgggaaattgctgaaataggtatagtgcgccagtattgccttgaaatt
gtaaaggatttctccgttaaattatttacaggagagtatggtcgtctggggtcatttgaa
aagcaaagacctgttaatcgtgaactacacggtattaaaagtgatagaagttgtcgtcac
atcgaatttatcatcagtgaaacaaagatgagatatgaggtgggtgatcacctaggtatt
tttccaacgaatgatccggtcaaggtggaggaattaggacgattgcttgaagctgatatg
gatctacgtttcagtctggttaatcttgatgaggaaaacttgaaaaagaacccattccca
tgtccatgtacaataagaactgcattcactcattacgttgatatttgtgcaccagttaag
tcgaatgtcctgaaagccttagctcatttcacaagtgatgaaaatgagaaagaacgtctt
ttattgttaagcacggcgaatgagcagggtttgaaggaatatgggaattatattcagaag
gaaaggcgttctattattgacattcttcgtgcatttccaacatgtaaacctccagttgat
tatattctagaattgttgccgcgacttcagccacgttattacagcatatcatcatcatcc
aaatacagtcatgactcactggcgataacagttattgtaacaaaatatgtgatcagcgat
cgattgattaaaggaggcgaaggctccaaagtaccaatatttcttagaaaatcaacaatg
cgacttccacaccgactgaaaacaccagttatcatgataggtcctgggacaggttttgct
ccatttagaggttttcttcaggagcggagttggcaaaaaaagcaaggacaagacattgga
ccaatgatattatattacggttgtcggcatccggaacatgatttcatttatgaagaagaa
ctgaagaagttcgtagaagatggtgtactttctgaattacacatagccttttctagactt
accgcaaagaaaatttacgtccaagacaaaatttggaagaatcgagaaaaagtgtggaaa
actattgagaatggtggaaatatttttttgtgtggcgatgcacgcaatatggcacgcgat
gtacaaaatacatttatacgaatattcatggaaattggtggaaaaaccgaaatcgaagca
cagaaatttcaaaaagatttggaacgaaagcgatgttatcaaacagatgtttggtcttaa

DBGET integrated database retrieval system