KEGG   Brugia malayi (filaria): Bm1_41990Help
Entry
Bm1_41990         CDS       T01050                                 

Definition
(RefSeq) Inositol monophosphatase family protein
  KO
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bmy  Brugia malayi (filaria)
Pathway
Sulfur metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bm1_41990
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Bm1_41990
Transfer RNA biogenesis [BR:bmy03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Bm1_41990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 331 aa AA seqDB search
MASNVMDLKGKQEMFKNSCFITQLVALSVSVAQRAGNIIKEWAFSGTGKSYYKGPVNLRD
LYTDADIAAEDCIISSLHKHFGNNLKVIGEENTEPMGTSVVNNFDSSVLVHDSKCSDEVR
QITSDDVVVWVDPLDGTYELVAAEGNISQQQEVTVLIGISYQGRPVAGVIHQPFWGTSAV
GRTVWAIKETGVHGVEIVKSNSQRYAVTTRSHSTVHIHDTLNILKEKNLINDVEFVGGAG
FKVLKCLEGAAAYVFPSPGCKKWDTCAPEAIITASGGKLTDISGNDLYYGADAQIPNNSG
VLATAHWINHQEFVDCIPERIKVLVPELARN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaatgtcatggatttgaaagggaagcaagaaatgttcaagaattcgtgtttt
ataactcagttagttgcattgtcagtaagtgttgctcagcgagccggcaatattatcaag
gaatgggctttcagtggcactggtaaatcatattataaaggacctgttaatttacgagat
ttatacacagatgcggatattgctgcggaagattgtattatttcatcattacacaagcat
tttgggaataatctaaaagttattggtgaagagaacactgaaccgatgggaacgagtgtg
gtaaataattttgattccagcgttttggtgcatgacagtaagtgcagtgatgaagtgcgc
cagataacgtcggatgatgtagttgtttgggtggatcctttggatggaacctatgaatta
gttgcagctgagggcaatatatctcaacagcaagaagtgaccgtacttattggcatatca
tatcaaggacggccagtggctggtgttatacatcagcctttttggggaaccagtgcggta
ggccgtacagtttgggcaattaaagaaacaggcgttcatggcgtggaaattgtaaaaagc
aattcacaacgatatgctgttacaacacgaagtcattccactgttcatattcatgacaca
ctaaatatcttgaaggaaaaaaatttaattaacgatgttgaatttgttggtggagccggg
tttaaggtcttaaaatgtttagaaggtgctgctgcttatgtttttcctagtcctggttgt
aaaaaatgggatacgtgtgctccagaagcaataattactgcatcaggtggcaaacttact
gatatctcaggaaatgatttatattatggtgcagatgcgcaaataccgaacaatagtggc
gtgctagcaacagcacattggataaatcatcaggaattcgtggactgcattccagaaaga
ataaaagtacttgtgccggaactagctcgtaactga

DBGET integrated database retrieval system