KEGG   Brugia malayi (filaria): Bm1_41990Help
Entry
Bm1_41990         CDS       T01050                                 

Definition
Inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bmy  Brugia malayi (filaria)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bmy00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 331 aa AA seqDB search
MASNVMDLKGKQEMFKNSCFITQLVALSVSVAQRAGNIIKEWAFSGTGKSYYKGPVNLRD
LYTDADIAAEDCIISSLHKHFGNNLKVIGEENTEPMGTSVVNNFDSSVLVHDSKCSDEVR
QITSDDVVVWVDPLDGTYELVAAEGNISQQQEVTVLIGISYQGRPVAGVIHQPFWGTSAV
GRTVWAIKETGVHGVEIVKSNSQRYAVTTRSHSTVHIHDTLNILKEKNLINDVEFVGGAG
FKVLKCLEGAAAYVFPSPGCKKWDTCAPEAIITASGGKLTDISGNDLYYGADAQIPNNSG
VLATAHWINHQEFVDCIPERIKVLVPELARN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaatgtcatggatttgaaagggaagcaagaaatgttcaagaattcgtgtttt
ataactcagttagttgcattgtcagtaagtgttgctcagcgagccggcaatattatcaag
gaatgggctttcagtggcactggtaaatcatattataaaggacctgttaatttacgagat
ttatacacagatgcggatattgctgcggaagattgtattatttcatcattacacaagcat
tttgggaataatctaaaagttattggtgaagagaacactgaaccgatgggaacgagtgtg
gtaaataattttgattccagcgttttggtgcatgacagtaagtgcagtgatgaagtgcgc
cagataacgtcggatgatgtagttgtttgggtggatcctttggatggaacctatgaatta
gttgcagctgagggcaatatatctcaacagcaagaagtgaccgtacttattggcatatca
tatcaaggacggccagtggctggtgttatacatcagcctttttggggaaccagtgcggta
ggccgtacagtttgggcaattaaagaaacaggcgttcatggcgtggaaattgtaaaaagc
aattcacaacgatatgctgttacaacacgaagtcattccactgttcatattcatgacaca
ctaaatatcttgaaggaaaaaaatttaattaacgatgttgaatttgttggtggagccggg
tttaaggtcttaaaatgtttagaaggtgctgctgcttatgtttttcctagtcctggttgt
aaaaaatgggatacgtgtgctccagaagcaataattactgcatcaggtggcaaacttact
gatatctcaggaaatgatttatattatggtgcagatgcgcaaataccgaacaatagtggc
gtgctagcaacagcacattggataaatcatcaggaattcgtggactgcattccagaaaga
ataaaagtacttgtgccggaactagctcgtaactga

DBGET integrated database retrieval system