KEGG   Brugia malayi (filaria): Bm1_42205Help
Entry
Bm1_42205         CDS       T01050                                 

Definition
Variant SH3 domain containing protein
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bm1_42205
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    Bm1_42205
   04020 Calcium signaling pathway
    Bm1_42205
   04070 Phosphatidylinositol signaling system
    Bm1_42205
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Bm1_42205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 907 aa AA seqDB search
MTSKINLRDVLYTIRHYAFINSEFPVILSIEDNCSVPVQRLLAREIREILGDYLLTAPVS
REETCLPSPEALKRKIILKHKKLPTESENIILQQADEDQEQDLLLLNFTRQGILSLKSGI
SDEWTTHLFILFPDRLCYMLEQCENNIDNQGILRRQDSLGNAHDDENQDVLTNLTGFGVP
PEEMHITEEWFHGKTDRDTARIRLLEHKDKGNGLFLVRDSTIFIGDYSLSFLHNEKVHHC
RIRTRMVNGEKKYYFLENKQMDTLYELISHYTKERLRTPNFSTTLITPCPQPCPHLGMIW
FCEKTDRNRAEELLNTVQQDGAFLLRFSSTDKNVFVLSLRVDGEIWHYHLKRDGRIFVVN
QTIFENLNQIVEYYSTREFVRGICLKYPVGEDTIIGSAGICCSTDRALGCYMELKDIDKE
VLVRAIESYNGSLPCELSFPVNAVINVFRKDGDRWRGKYRGRSGFFPSRCVIELETSDNQ
PSELGPYAAIDLADSLIEEVPFEIAGRPFAFKIRRVSTHWNPSEYVLAANSSEEREDWLN
ILHELMRTVTDRNTLIRTREKNLRIASELSDLVVYCQAVPFNSQFATQGNFYEMCSFSET
KFEKLVERGLVQFNARQLSRVYPQGSRVTSANYDPVPMWNAACHMVALNYQTGDRSMQLN
QGKFMANGQCGYVLKPSYMIDEMFSPDAAEVVSTSCPIILTVHVVGGQHLSRKDRNRGIC
SPTVTVEVVGLPADSTSVRTRAIASNGLNPVWNEKFIFKVYCPEIALLRLYVEDGDFMGP
KMDPFIGQAVYPLDCIRTGFRSVPLRNQYSEELELSSLLVYLDMRRRSNEAEVLNPHVDL
QSDRYVAGGLHKTLTSSGVFSARLNSTDQSSFTVPLTPNLSVAKQVQVLMDSTACINSPN
VAHVCEK
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgactagtaaaatcaatttacgcgatgtgctttataccattcgtcattatgcttttatc
aatagcgagtttccagtaattctctcgattgaagacaattgttcagtaccggtacaacgc
ctacttgctcgtgaaattagagaaattcttggtgattatttactcacagctccagttagt
cgtgaagaaacttgtttaccatctccggaagctttaaagcgaaaaattattctaaagcat
aaaaagctaccgacagaaagtgaaaatattatcttacagcaagctgatgaggatcaagag
caggatttgcttttgctgaattttacgcggcaaggaattctgtcattgaagagcggaata
agcgatgaatggacaactcatttatttatattgtttccggatcgtttatgttacatgttg
gaacagtgcgagaataatattgataatcagggtattctgagacgtcaagattcattggga
aacgcacatgatgatgaaaatcaagatgttttgacaaacttgacgggttttggtgttcct
ccagaggaaatgcatattacagaagaatggtttcacggtaaaacagatcgagatacggca
agaattcgccttttggagcataaagataaaggcaatggtctttttttggttcgcgattcg
actatttttattggcgactactcgttatcatttctacataatgaaaaagtacatcactgt
cgaatacgcacaaggatggtgaatggtgaaaaaaaatattattttttggaaaataagcaa
atggatacactttatgaacttatatcgcactatacaaaggaaagattgaggacacctaat
tttagcacgacactgatcactccatgtccgcagccttgtcctcatctcggcatgatatgg
ttttgtgagaaaacagatagaaatcgtgccgaagaactgctgaacacagttcaacaagat
ggggctttcttgctgcgctttagttctactgataaaaacgtttttgtgctttctctgaga
gttgacggcgaaatatggcactaccatttgaaacgcgatggtcgaatttttgttgttaac
cagactattttcgagaatttgaatcaaatagttgaatattattcaacaagggaattcgtt
cgtggaatatgtctaaaatatcctgtgggtgaggataccattattggttctgcaggtata
tgctgtagtaccgaccgggcacttggttgttacatggaactcaaagacattgataaagag
gtattggttcgagctatcgagtcctacaatggatctcttccctgtgaactttcwttccct
gtaaatgcggtgataaatgtattcaggaaagatggcgaccgctggcgtggcaaatatcgc
ggtcgttcaggtttcttcccttctcgatgcgttattgaactagaaacttctgataatcaa
ccgagtgagttggggccttacgcagctatcgatttggccgattctttaattgaagaagta
ccgtttgaaattgctggtcgaccgtttgcatttaaaatcagacgtgtttcaacgcactgg
aatccaagcgaatacgttttagctgccaattcaagtgaagaacgtgaagactggttaaat
attctacatgagctgatgaggacagttacggatcgcaataccttgatacgtacacgagag
aaaaatctgcgaatagcttctgaattatctgatttggtggtttactgccaggcggtccct
ttcaattcacagtttgcaacacaaggcaatttctatgaaatgtgctcgttcagtgaaaca
aaattcgaaaaattggtagaacgaggtttagttcagtttaatgctcgtcagttgtcacgc
gtttatccgcaaggttcacgtgtaacttcagcaaattatgatccagtaccaatgtggaat
gctgcatgtcatatggttgcattgaactaccaaactggcgacaggtcgatgcaacttaat
caaggcaaatttatggcgaatggtcagtgtggatatgtactgaaaccgtcttatatgatc
gatgaaatgttttctcccgatgctgccgaagttgtatctacctcttgtccaatcattctt
actgttcatgtagtaggaggacaacatttgtcaaggaaagatagaaatcgaggtatctgt
tctcctactgttactgtagaagttgtgggtttgccggctgattcaactagtgttcgaaca
cgagctattgcttccaatggcttgaatcctgtttggaatgagaaattcatcttcaaagtg
tactgtccagaaatagctttacttcgcttgtatgttgaagatggcgattttatgggacct
aagatggatccatttattggacaagctgtgtatccacttgactgcattcgcactggtttt
cgatccgtaccacttcgtaatcaatacagcgaggaattggaattgtcgtcattacttgtt
tatctcgatatgcgccgtcgaagtaatgaagcagaagttctaaatccacatgttgatttg
caatctgaccgatatgttgccggtggattgcacaagacattaacatcgtctggcgtattt
tcggcacggttgaattcaactgatcaaagtagtttcacggtaccattaacacccaattta
tcagttgcaaaacaagtccaagttytaatggattcgacggcttgcattaatagtcctaat
gtagcccatgtttgtgaaaaatga

DBGET integrated database retrieval system