KEGG   Brugia malayi (filaria): Bm1_44265Help
Entry
Bm1_44265         CDS       T01050                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_44265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1334 aa AA seqDB search
MWVKARNTFRVIDDYINSCYNEQSSSTSLEQLIAVLNKAQPLLVNILRNPSKNSLHRSVL
NKSGEVLELDSGEVVKVDDGLRNEAIIISDLFNCDEFDALELVITGEVQIRHFPFLTRGL
CAVVCYYDSHRFISAAVKALAEFKVDEKLPKSRELFEYLNQLLSDTAFIRRLIEVLQTVN
VQSELQSLHHPNVNGLGGPKHQEILRELIEDTLENCAQTLHLICSSWQLESAPPFLKDLF
APLKELQPNIAFKNTHLSLWTATLILISPHNLQNMRCARDLLMGFHKEVFLEDWQDSCLQ
ASLQFAIVVSYNWLSVHQLVQEVLGGFSIKEDDLLEKAVDGLAFQFIRKCVISMPKFRKS
FIAFATVDTLIKNFIAHLSNQVILLQHSGEIELQYVEEMLERGQLHRPRLHFENFIRCIA
DLYDGDSKYLEQLSAQFCSSESEELVKFLRNCRQLISPVLQVAFLDMLKNICKCRESACF
IFGLLSPCHTKSVQSTLSWDHFWTAMHDYLGLFKRKKSQTSSIMHATHPGQHDTFQQIPQ
SELAGLVAWVQLVEIVAKNDQISRRHFADNSSWSCIETAISLVASAIPLVLKGALFRCLA
SLAMDEHGAVKIWTTLISLSVLTKTSSGKLVGIQWHLCSAACDALYNFLHHYAITAEAIL
DADPQIIVLTQILNDSPVFRSLSAVLCDGAERLHDFSPRSIDREAAVLSVLRLLDVSVSL
HAPLIDAVRATNSSIIIASLDSLFLSSVESNGVTTYITVIASYLTQSELIPKHIYYVVSI
LRELCCCQPSIQSRIVQALLPLSLELIESFARLTSVKMAAIEVSALDSPVYHGIDELPVA
RVRGETARLFIEMCSSSIENDPGTTNLVYLFCGLRMPDLVNSVIESTGELWFHKYVHKGT
TMTCLHSLVDLLIEMTTSEAPFALPFAALFEPTLRLMLRLVSINCSCSTVILRFFRSNHD
LIYRLTSFLLLLDTKTHSDEEEDMVLKNLKITIQGLVLHLSAVELSSLLQNRHYSQPKRY
FHLMLSQRDDVMEEQNSAVEQALGQSDIGYTPNKQRDEEEWPFLWRLLRTKANFNEMEIP
VMELLNTKRLEQILSLCLRPTSANVQQCDIEHLNWLLCREFSMVANEMQPKFNFGISQDT
KQLLQYCTTYNLMKNAEASLRQLLSGWLSFVNVLAIFCPVPFLTLGKLTASICALLKSLK
EEVVEFRTTITDVADVLIRFLIQPGTFILLHALLIHDSKRSLQTKLDLYACISLILNYST
EALVSEREEYQDISRSDDDFLFGLTTLKIAQQDILRNALTKYGHELISLLSKDICDSPSG
LRHLVVICVVKIEN
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgaaggctcggaacactttcagggtaatcgatgattatataaatagctgttac
aatgaacagagcagtagtacttcactggaacaactgatagctgtactaaacaaagcccag
ccattactcgtcaatatacttcggaatccaagtaaaaattcactgcatcgttcggtgctg
aacaagagtggtgaagtactggaattagacagtggagaagtcgtgaaagtggatgatgga
ctacggaacgaagcaataattatatcagatttgtttaattgtgatgaatttgatgctctt
gaactagtaataactggtgaggtacaaatacggcattttccgttcttaacgagaggactt
tgtgctgttgtttgctactatgattcacatcgttttatcagtgcagctgtcaaagctctg
gcagaattcaaagttgacgaaaagttaccgaaatcacgcgagctttttgaatatcttaat
cagttgcttagtgatactgcctttattagacgtcttattgaagtcttgcaaaccgtaaat
gtgcaatctgaattacaaagtttacatcatccaaatgtaaatggattaggtggccctaaa
catcaggaaattttgcgagaattaattgaagacacgttagaaaactgtgcacaaacactc
catcttatatgctcatcctggcaattggaatcagcaccaccctttttaaaggatttattt
gcaccgctgaaagaactgcagccgaatatagctttcaaaaatacccatttatcactgtgg
accgctactttaatactgatatctccacacaatcttcaaaacatgcgatgtgctcgagat
ttgttgatgggatttcacaaagaagtatttttggaggactggcaagattcttgtctgcag
gcttctctacagtttgcaatcgtggtttcatacaactggcttagtgttcatcagctcgtt
caagaagttctgggtggcttttctatcaaagaagatgatttgcttgaaaaggcagtcgat
ggattagccttccagttcatacggaaatgtgttatttcaatgccaaaatttagaaaaagt
ttcatagcttttgctacggttgacaccttgatcaaaaattttattgctcatctcagtaat
caggtcattctgttacaacattccggcgaaatagaattacagtacgtggaagaaatgttg
gaacgtggtcagcttcacaggcctcggcttcattttgaaaattttattcgttgtattgct
gatttgtatgatggtgattcgaaatatttggagcagttgtctgcacaattttgctctagt
gagagtgaagaattggtgaagtttttgagaaactgtcggcaacttatttcaccggtactc
caggtcgcttttctcgatatgttaaaaaacatctgcaaatgtcgagaatcggcatgcttc
atatttggactgctttctccatgtcatacaaaatccgttcaaagtacgttgtcttgggat
catttctggacagcaatgcatgactatcttggacttttcaaacgaaaaaaaagtcaaaca
tcgagtataatgcatgcaacacacccggggcaacatgatactttccagcagatcccacaa
tccgagttagccggccttgtggcatgggttcagcttgtagaaattgttgctaaaaatgac
cagatttctcgtcgccatttcgcagataacagttcatggtcatgcatagaaacagcaata
agtttggtagcttctgccattcccctcgttttgaagggagcgctgttccgttgtttagcg
tcacttgcaatggacgaacatggggctgtgaagatttggacaacattgatatcactctct
gttttgactaaaacaagttctggaaaacttgttggtatacaatggcatttatgctctgca
gcatgcgacgctttgtataattttcttcaccattatgctattacagcagaagcaattctg
gatgcagatccgcaaattattgtccttacacaaattttaaatgattctcctgtatttcga
tcgttgagtgcagtattatgtgatggagcggaacgtttgcatgatttctcccctcgctca
atagaccgcgaagcggctgtcttatcagtactgcgtttgttggatgtcagcgtgtcatta
catgcacctttaatagatgcagttcgtgcgactaattccagtataataattgcatcattg
gattcacttttcttatcatcagtagaaagtaacggggtaacaacgtatataacagttatc
gcctcatatttgacacagtcggagctcatcccaaaacatatatattacgtagtgtcaatt
ttgcgggaactttgctgttgtcaaccttccatacaaagtcgtattgtacaagcgcttttg
ccgctttctttagaattaattgaaagttttgcgcgattgacttccgtgaaaatggcggcg
attgaagtctcggctcttgattcacctgtttatcatggaattgacgagttgccagtggcg
agagtacgtggtgaaacagcacgcttattcattgaaatgtgttcgtctagtattgagaat
gatccaggcaccactaatttagtctatcttttctgtggtctcagaatgccagatttggta
aattccgtcattgagtccacaggcgagttgtggtttcataaatatgttcacaaaggtacc
acaatgacttgtctacatagtctagttgatttactaatagaaatgacaacttctgaagct
ccatttgcactcccatttgctgcgcttttcgaaccaacacttcgattaatgttgcgactg
gtatcaataaactgtagttgttcaactgttatccttaggtttttccgctcaaaccacgac
cttatttatcgcttaacatcttttctattgcttttggatacaaaaacgcatagcgatgaa
gaggaagatatggtgctaaagaatttaaaaatcactattcaaggactggtgttacattta
agcgcagttgaattgtcttctctgttacagaatcgtcactacagtcagccaaaacgttac
tttcatcttatgctatcgcagagggatgatgtaatggaagagcaaaattcagcagttgag
caagcactgggacaaagtgatattggctacaccccaaataaacaaagggatgaagaagag
tggccttttttatggagattactaagaactaaagctaattttaatgaaatggagattccg
gtaatggaattgcttaatacaaaaagactggagcagatcttgtcgttatgtttgcgtccc
acatctgcaaatgttcagcaatgtgatatcgagcatttaaactggttactttgtagagaa
tttagcatggttgctaatgaaatgcagcccaaattcaattttggaatttcacaggatact
aagcaattgcttcaatactgcacaacttataacctcatgaaaaatgcagaagcgtcactg
cgacagcttctttctggttggctatcgtttgtaaatgttctcgctatattttgtccggtt
ccatttcttaccctgggcaaattgactgcttcgatctgtgcactactaaagagtttgaaa
gaagaagttgttgagtttagaaccactattactgatgttgctgatgttttgattcggttt
ctgatacaaccaggcacgtttattctacttcatgctttacttatacatgatagtaaacgg
tcgttacagacgaagctagatttatatgcttgcatttcgcttattttaaactattcaact
gaagcacttgtttcggagagagaggaatatcaggacatttctcgttccgatgatgacttt
ctctttggtttaacaacattaaaaattgcacagcaagatattttgcgaaatgcgctcaca
aagtatggacatgaactaatttcactgttgtccaaagatatttgtgattcaccatcagga
cttagacatttagtggtaatttgtgttgtaaaaatagagaactaa

DBGET integrated database retrieval system